STAT5B Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human STAT5B |
STAT5B Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human STAT5B |
Anti-Human EGF Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived recombinant Human EGF |
Rabbit Polyclonal c-jun Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
EGF mouse monoclonal antibody, clone KT2, Aff - Purified
Applications | ELISA |
Reactivities | Human |
JNK1 (MAPK8) (318-427) mouse monoclonal antibody, clone 3H2, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone TB21, Aff - Purified
Applications | Assay, ELISA, FC, IHC, NEUT, WB |
Reactivities | Human |
Flt3 ligand (FLT3LG) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 180-230 of Human Flt3-L. |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | beta-specific amino acid sequence chosen from the middle of the beta Catenin (p120) protein. |
TGF beta 1 (TGFB1) mouse monoclonal antibody, clone 8C4, Azide Free
Applications | ELISA, FN, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal Antibody against CASP3 (Clone E83-103)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K). |
Modifications | Phospho-specific |
Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C). |
Modifications | Phospho-specific |
Rabbit Polyclonal JNK1/2/3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human JNK1/2/3 |
Rabbit anti-PDGFRB Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PDGFRB |
Mouse Monoclonal AKT(pan) Antibody
Applications | WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal AKT1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
WNT3A mouse monoclonal antibody, clone 3A6, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
IGF1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, FN, IHC, WB |
Reactivities | Human |
Immunogen | Highly pure (>98%) recombinant hIGF-1 (human Insulin Like Growth Factor-1) |
Rabbit Polyclonal Antibody against AKT2 (N-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Rabbit Polyclonal Akt1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1. |
Rabbit polyclonal anti-PDGFR a antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PDGFR a. |
Rabbit polyclonal anti-Gli-3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit Polyclonal c-Jun (Ser73) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Jun around the phosphorylation site of Serine 73 |
Modifications | Phospho-specific |
Rabbit polyclonal p44/42 MAPK antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human ERK1/2. |
ITGAV Rabbit Polyclonal Antibody
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human ITGAV |
Anti-Human IGF-I Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human IGF-I |
Rabbit Polyclonal Anti-WNT5A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit anti-AXIN2 Polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human AXIN2 |
Rabbit anti-AKT1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human AKT1 |
Phospho-BCL2L1-S62 Rabbit Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho specific peptide corresponding to residues surrounding S62 of human BCL2L1 |
Modifications | Phospho-specific |
Rabbit Polyclonal BMP-2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643] |
Rabbit Polyclonal AKT2 Antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
CDH1 Capture mouse monoclonal antibody, ELISA and Luminex validated, clone OTI4F1
Applications | ELISA, LMNX |
Reactivities | Human |
Conjugation | Unconjugated |
Matched ELISA Pair | TA700197 |
EGF mouse monoclonal antibody, clone S-147, Aff - Purified
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
beta Catenin (CTNNB1) mouse monoclonal antibody, clone EM-22, Aff - Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Hamster, Human, Mouse |
BCL2 (41-54) mouse monoclonal antibody, clone Bcl2/100, Aff - Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human |
c Kit (KIT) mouse monoclonal antibody, clone B-K15, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
JNK1 (MAPK8) (318-427) mouse monoclonal antibody, clone 2F3, Purified
Applications | ELISA, IHC, IP, WB |
Reactivities | Human |
E Cadherin (CDH1) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 840-880 of Human E-cadherin. |
AKT1 (C-term) rabbit polyclonal antibody, Serum
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Chicken, Human, Mouse, Rat |
Immunogen | Synthetic peptide -KLH conjugated corresponding to the C-terminus (460-480) of Human, Rat, Mouse and Chicken AKT proteins conjugated to KLH using maleimide. |
beta Catenin (CTNNB1) rabbit polyclonal antibody, Purified
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse |
Immunogen | beta-specific amino acid sequence chosen from the middle of the beta Catenin (p120) protein. |
IGF1 mouse monoclonal antibody, clone M23/ILG1-001, Purified
Applications | ELISA, R |
Reactivities | Human |
Goat Polyclonal Antibody against BCL2
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AGRTGYDNREIVMKYC, from the N Terminus of the protein sequence according to NP_000624; NP_000648. |
Rabbit Polyclonal Bcl-2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Bcl-2 antibody was raised against a peptide corresponding to 15 amino acids near the N-terminus of human Bcl-2. |
Rabbit Polyclonal Laminin Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Laminin isolated from mouse EHS tumor. |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit polyclonal Akt (Ab-129) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Rabbit polyclonal anti-TGF Beta1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β1 antibody. |
Mouse Balb/c monoclonal Akt phospho S473 ATTO594 Conjugated antibody
Applications | IF, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |