Germany
Japan
United Kingdom
China
Rabbit Polyclonal GluR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR2 |
Primary Antibodies
View as table Download
Rabbit polyclonal Anti-VPAC1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)EEAQLENETIG(S)SK, corresponding to amino acid residues 52-65 of human VPAC1 (Accession P32241). Extracellular, N-terminus. |
Rabbit anti-CHRM5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM5 |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR |
Rabbit Polyclonal Anti-NTSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT |
Goat Polyclonal Anti-ADRA1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADRA1B Antibody: Peptide with sequence C-SSTKAKGHNPRSS, from the internal region of the protein sequence according to NP_000670.1. |
Rabbit Polyclonal Anti-CHRM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHRM1 |
HRH1 (C-term) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Canine, Human, Mouse, Rat |
| Immunogen | Peptide with sequence from the C Terminus of the protein sequence according to NP_000852.1; NP_001091681.1; NP_001091682.1; NP_001091683.1. |
Mouse anti-GnRHR monoclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ADRB3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ADRB3 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human ADRB3. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Monkey (94%). |
Rabbit anti-CHRM1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM1 |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the C terminal of human TSHR. Synthetic peptide located within the following region: KLDAVYLNKNKYLTVIDKDAFGGVYSGPSLLLPLGRKSLSFETQKAPRSS |
NPY1R rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 225-270 of Human NPY1-R. |
Goat Polyclonal Antibody against MC2R
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence ENINNTARNNSDC, from the N Terminus of the protein sequence according to NP_000520.1. |
Rabbit Polyclonal antibody to Histamine H2 Receptor (histamine receptor H2)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 45 of Histamine H2 Receptor (Uniprot ID#P25021) |
Rabbit Polyclonal antibody to alpha 1a Adrenergic Receptor (adrenergic, alpha-1A-, receptor)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 206 and 260 of alpha 1a Adrenergic Receptor (Uniprot ID#P35348) |
Rabbit polyclonal anti-CCKBR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CCKBR. |
Rabbit polyclonal anti-HTR7 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HTR7. |
USD 425.00
In Stock
CHRM3 / M3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Monkey, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CHRM3 / M3 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human CHRM3 / M3. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Chimpanzee, Mouse, Rat, Sheep, Hamster, Elephant, Dog, Bovine, Horse, Rabbit, Pig, Guinea pig (95%); Opossum, Turkey, Chicken, Lizard (89%). |
FPR2 / FPRL1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | FPR2 / FPRL1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human FPR2 / FPRL1. Percent identity with other species by BLAST analysis: Human (100%); Chimpanzee, Gorilla, Monkey (95%); Orangutan (90%); Dog (85%). |
B1R / BDKRB1 Rabbit Polyclonal (Extracellular Domain) Antibody
| Applications | IHC |
| Reactivities | Human, Monkey, Gorilla |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Gibbon (94%); Rat, Hamster (89%); Mouse, Rabbit, Horse (83%). |
HRH1 / H1 Receptor Goat Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Chimpanzee, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | HRH1 / Histamine H1 Receptor antibody was raised against synthetic peptide CNENFKKTFKRILH from the C-terminus of human HRH1 / Histamine H1 Receptor (NP_000852.1; NP_001091681.1; NP_001091682.1; NP_001091683.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Bat, Platypus (100%); Monkey, Mouse, Rat, Dog, Bovine, Hamster, Elephant, Panda, Rabbit, Horse, Pig, Turkey, Chicken (93%); Marmoset, Guinea pig, Xenopus (86%). |
Rabbit anti-PTH1R Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Rat, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PTH1R |
P2RY6 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human P2RY6 |
Rabbit anti-DRD1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human DRD1 |
Rabbit Polyclonal Anti-A2B Adenosine Receptor (extracellular)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Peptide KDSATNN*STEPWDGTTNESC, corresponding to amino acid residues 147-166 of human A2B Adenosine Receptor with replacement of cysteine 154 (C154) with serine (*S). 2nd extracellular loop. |
Rabbit Polyclonal Anti-Sphingosine 1-Phosphate Receptor 1 (extracellular)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide SDYVNYDIIVRHYN(C), corresponding to amino acid residues 17-30 of human Sphingosine 1-Phosphate Receptor 1 (S1PR1). Extracellular, N-terminus. |
Active filters
Families
- GPCR
Pathways
- Neuroactive ligand-receptor interaction
Filter by
Category
Target Symbol
- GPR83 (19)
- F2R (14)
- ADRA1B (13)
- SSTR3 (13)
- ADRB2 (12)
- CRHR1 (11)
- HCRTR1 (11)
- HTR4 (11)
- NTSR1 (11)
- FPR1 (10)
- GABBR1 (10)
- GRM4 (10)
- GRM7 (10)
- HTR7 (10)
- PTGER3 (10)
- SSTR1 (10)
- C5AR1 (9)
- FPR2 (9)
- GRM3 (9)
- HTR5A (9)
- LPAR1 (9)
- LPAR4 (9)
- NPY1R (9)
- S1PR1 (9)
- SSTR2 (9)
- SSTR4 (9)
- SSTR5 (9)
- TSHR (9)
- ADORA2A (8)
- ADRA2A (8)
- APLNR (8)
- CHRM1 (8)
- CNR2 (8)
- GHRHR (8)
- GRM1 (8)
- GRM2 (8)
- HTR1F (8)
- HTR2C (8)
- P2RY2 (8)
- ADRA2C (7)
- AVPR1B (7)
- BDKRB1 (7)
- CYSLTR1 (7)
- DRD1 (7)
- GIPR (7)
- GRM5 (7)
- GRM8 (7)
- HTR1A (7)
- KISS1R (7)
- NPY2R (7)
- OPRM1 (7)
- PTGER2 (7)
- RXFP1 (7)
- S1PR3 (7)
- ADRA1A (6)
- ADRB3 (6)
- AGTR1 (6)
- AVPR1A (6)
- BRS3 (6)
- CYSLTR2 (6)
- FSHR (6)
- GHSR (6)
- GLP2R (6)
- GNRHR (6)
- GPR50 (6)
- GRPR (6)
- HRH1 (6)
- HRH2 (6)
- HRH4 (6)
- HTR1E (6)
- LPAR3 (6)
- LTB4R2 (6)
- MAS1 (6)
- MC1R (6)
- MC2R (6)
- MC4R (6)
- MC5R (6)
- MTNR1A (6)
- NMBR (6)
- P2RY13 (6)
- TACR1 (6)
- ADORA1 (5)
- ADORA2B (5)
- ADORA3 (5)
- ADRB1 (5)
- CHRM2 (5)
- CHRM5 (5)
- CNR1 (5)
- DRD2 (5)
- DRD4 (5)
- EDNRA (5)
- EDNRB (5)
- F2RL2 (5)
- FPR3 (5)
- GCGR (5)
- GLP1R (5)
- LPAR6 (5)
- NTSR2 (5)
- P2RY1 (5)
- PRLHR (5)
Reactivities
- Human (739)
- Mouse (388)
- Rat (370)
- Monkey (64)
- Dog (53)
- Gorilla (33)
- Bovine (32)
- Rabbit (31)
- Pig (29)
- Horse (26)
- Bat (25)
- Hamster (22)
- Gibbon (21)
- Cow (14)
- Chimpanzee (12)
- Guinea Pig (8)
- Chicken (7)
- Primate (6)
- Xenopus (6)
- Orang-Utan (5)
- Rhesus Monkey (5)
- Canine (3)
- Sheep (2)
- Zebrafish (2)
- Feline (1)
- Goat (1)
- Macaque (1)
- Murine (1)
- X. tropicalis (1)