Rabbit Polyclonal Anti-Neurotensin Receptor 1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide EQNRSADGQHAGGLVC corresponding to amino acid residues 209-224 of human Neurotensin Receptor 1. 2nd extracellular loop. |
Rabbit Polyclonal Anti-Cannabinoid Receptor 2 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)NGSKDGLDSNPMKD, corresponding to amino acid residues 11-24 of human Cannabinoid Receptor 2. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: ELIARNTWTLKKLPLSLSFLHLTRADLSYPSHCCAFKNQKKIRGILESLM |
Rabbit Polyclonal Anti-mGluR8 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-mGluR8 Antibody: A synthesized peptide derived from human mGluR8 |
Rabbit Polyclonal Anti-GRM5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GRM5 Antibody: A synthesized peptide derived from internal of human GRM5. |
C5R1 (C5AR1) mouse monoclonal antibody, clone 3H1738, Purified
| Applications | FC, FN, IHC, NEUT |
| Reactivities | Human, Rabbit |
HTR2C rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 400-450 of Human SR-2C. |
Dopamine D2 Receptor (DRD2) (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 306-336 amino acids from the C-terminal region of Human Dopamine D2 receptor. |
USD 620.00
2 Weeks
Dopamine D2 Receptor (DRD2) (long isoform, 243-254) rabbit polyclonal antibody, Serum
| Applications | ELISA, IF, IHC, WB |
| Reactivities | Human, Rat |
| Immunogen | D2L (243-254) cyclized covalently attached to a carrier protein. |
USD 531.00
In Stock
Goat Polyclonal Antibody against Cholinergic receptor / CHRM1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DKRRWRKIPKRPGSVH, from the C Terminus of the protein sequence according to NP_000729.2. |
Goat Polyclonal Antibody against AGTR1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EIQKNKPRNDDIFK, from the internal region of the protein sequence according to NP_000676.1; NP_004826.2; NP_033611.1; NP_114038.1; NP_114438.1. |
Rabbit polyclonal antibody to MEL-1A-R (melatonin receptor 1A)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 80 and 172 of Melatonin Receptor 1A (Uniprot ID#P48039) |
USD 345.00
In Stock
Rabbit polyclonal anti-KITH_VZV7 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human KITH_VZV7. |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
CALCRL / CRLR Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 15 amino acid peptide from N-terminal extracellular domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey (100%); Marmoset, Mouse, Rabbit (93%); Rat, Panda, Dog, Horse, Pig (87%); Goat, Bovine (80%). |
NPBWR2 / GPR8 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | NPBWR2 / GPR8 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human NPBWR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (94%); Gibbon (88%). |
LGR7 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | RXFP1/ LGR7 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human RXFP1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan (100%); Gibbon, Monkey (95%); Marmoset (84%). |
EDG1 / S1P1 Rabbit Polyclonal (aa25-40) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | S1PR1 / EDG1 / S1P1 antibody was raised against synthetic peptide from human S1PR1 / EDG1. |
Rabbit polyclonal CB2 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 329-356 amino acids from the C-terminal region of human CB2. |
Germany
Japan
United Kingdom
China
