CD8A mouse monoclonal antibody, clone B-Z31, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD8A mouse monoclonal antibody, clone B-Z31, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD8A mouse monoclonal antibody, clone B-Z31, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD8A mouse monoclonal antibody, clone MCD8, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD8A mouse monoclonal antibody, clone MCD8, PerCP
Applications | FC |
Reactivities | Human |
Conjugation | PerCP |
CD8A mouse monoclonal antibody, clone MCD8, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD40L (CD40LG) (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the N-terminal region of human TRAP |
CD40 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of mouse CD40 |
CD8A mouse monoclonal antibody, clone 144B, Supernatant
Applications | IHC |
Reactivities | Human |
CD8A rabbit monoclonal antibody, clone SP16, Supernatant
Applications | IHC |
Reactivities | Human |
CD8A rat monoclonal antibody, clone YTC 182.20, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD8A mouse monoclonal antibody, clone LT8, APC
Applications | FC |
Reactivities | Human |
Conjugation | APC |
CD8A mouse monoclonal antibody, clone LT8, APC
Applications | FC |
Reactivities | Human, Monkey |
Conjugation | APC |
CD8A mouse monoclonal antibody, clone LT8, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
CD8A mouse monoclonal antibody, clone LT8, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD8A mouse monoclonal antibody, clone LT8, FITC
Applications | FC |
Reactivities | Human, Monkey |
Conjugation | FITC |
CD8A mouse monoclonal antibody, clone LT8, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD8A mouse monoclonal antibody, clone LT8, PE
Applications | FC |
Reactivities | Human, Monkey |
Conjugation | PE |
CD8A mouse monoclonal antibody, clone MEM-31, APC
Applications | FC |
Reactivities | Human |
Conjugation | APC |
CD8A mouse monoclonal antibody, clone MEM-31, Biotin
Applications | FC |
Reactivities | Human |
Conjugation | Biotin |
CD8A mouse monoclonal antibody, clone MEM-31, FITC
Applications | FC |
Reactivities | Human |
Conjugation | FITC |
CD8A mouse monoclonal antibody, clone MEM-31, PE
Applications | FC |
Reactivities | Human |
Conjugation | PE |
CD8B mouse monoclonal antibody, clone CC58, PE
Applications | FC |
Reactivities | Bovine |
Conjugation | PE |
CD8A mouse monoclonal antibody, clone CT6, FITC
Applications | FC |
Reactivities | Guinea Pig |
Conjugation | FITC |
Rabbit polyclonal anti-IGLL1 antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human IGLL1. |
Rabbit polyclonal anti-CD40 antibody
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Pig |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to residues surrounding amino acids 261 of human CD40 |
Mouse Anti-Human CD154 (CD40 Ligand) Purified (25 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human CD8a Purified (100 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human CD8a Purified (100 ug)
Reactivities | Human |
Conjugation | Unconjugated |
Mouse Anti-Human CD278 (ICOS) Purified (25 ug)
Applications | FC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-CD8B antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: LCCRRRRARLRFMKQPQGEGISGTFVPQCLHGYYSNTTTSQKLLNPWILK |
Mouse monoclonal Anti-Leu2 Clone UCH-T4
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Leu2 Clone C8/144B
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Leu2 Clone X107
Reactivities | Human |
Conjugation | Unconjugated |
Mouse monoclonal Anti-Leu2 Clone BU88
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti CD154 Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to aa 51-69 of human CD154. |
Rabbit anti CD8 Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti CD40 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse anti CD8(T8)-Hu Monoclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD8A mouse monoclonal antibody,clone OTI3H6
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD8A mouse monoclonal antibody, clone OTI7C10 (formerly 7C10)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI8B8 (formerly 8B8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI7H2 (formerly 7H2)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI8G5 (formerly 8G5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI8C5 (formerly 8C5)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI6C12 (formerly 6C12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI9D8 (formerly 9D8)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI9F4 (formerly 9F4)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CD40 mouse monoclonal antibody, clone OTI7F6 (formerly 7F6)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |