Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit Polyclonal Antibody against CD8A (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 59-88 amino acids from the N-terminal region of human CD8A. |
CD8A mouse monoclonal antibody, clone CT6, Supernatant
| Applications | FC, IHC |
| Reactivities | Guinea Pig |
CD40 (C-term) rabbit polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | CD40 antibody was raised against a synthetic peptide derived from C-terminal of human CD40 |
Mouse Anti-Human CD40 Purified (100 ug)
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-CD40LG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40LG antibody: synthetic peptide directed towards the middle region of human CD40LG. Synthetic peptide located within the following region: ENSFEMQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLEN |
Rabbit Polyclonal Anti-IGLL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IGLL1 antibody: synthetic peptide directed towards the N terminal of human IGLL1. Synthetic peptide located within the following region: RSRWGRFLLQRGSWTGPRCWPRGFQSKHNSVTHVFGSGTQLTVLSQPKAT |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD |
Rabbit Polyclonal Anti-CD40 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD40 antibody: synthetic peptide directed towards the N terminal of human CD40. Synthetic peptide located within the following region: WNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCV |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the N terminal of human CD8B. Synthetic peptide located within the following region: RIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFI |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B antibody: synthetic peptide directed towards the middle region of human CD8B. Synthetic peptide located within the following region: KPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCR |
Rabbit Polyclonal Anti-CD8A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8A Antibody: A synthesized peptide derived from human CD8A |
Rabbit Polyclonal Anti-CD8B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD8B Antibody: A synthesized peptide derived from human CD8B |
CD8A mouse monoclonal antibody, clone LT8, Azide Free
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone LT8, Purified
| Applications | FC, IHC, IP |
| Reactivities | Human, Monkey |
Rabbit Polyclonal Antibody against CD8A (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CD8A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 150-180 amino acids from the C-terminal region of human CD8A. |
CD8A mouse monoclonal antibody, clone RFT-8, APC-Cy7
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | APC-Cy7 |
CD8A mouse monoclonal antibody, clone RFT-8, Cy5
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | Cy5 |
CD8A mouse monoclonal antibody, clone RFT-8, Low Endotoxin
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy5.5
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE-Cy5.5 |
CD8A mouse monoclonal antibody, clone RFT-8, PE-Cy7
| Applications | FC, IHC |
| Reactivities | Human |
| Conjugation | PE-Cy7 |
CD8A mouse monoclonal antibody, clone CA-8, Aff - Purified
| Applications | IHC, IP |
| Reactivities | Human, Rat |
CD8A mouse monoclonal antibody, clone B-Z31, Azide Free
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone B-Z31, Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD8A mouse monoclonal antibody, clone MCD8, Aff - Purified
| Applications | FC, IHC |
| Reactivities | Human |
CD40L (CD40LG) (C-term) rabbit polyclonal antibody
| Applications | FC, WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human TRAP |
CD8A mouse monoclonal antibody, clone MEM-87, Purified
| Applications | FC, IP |
| Reactivities | Human |
Mouse Monoclonal CD8 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD8A mouse monoclonal antibody, clone 17D8, APC
| Applications | FC |
| Reactivities | Human |
| Conjugation | APC |
CD8A mouse monoclonal antibody, clone RFT-8, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
CD8A mouse monoclonal antibody, clone RFT-8, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD8A mouse monoclonal antibody, clone RFT-8, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD8A mouse monoclonal antibody, clone RFT-8, PE-TXRD
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE-TXRD |
CD40 mouse monoclonal antibody, clone B-B20, Biotin
| Applications | FC |
| Reactivities | Human |
| Conjugation | Biotin |
CD40 mouse monoclonal antibody, clone B-B20, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD40 mouse monoclonal antibody, clone B-B20, Purified
| Applications | FC |
| Reactivities | Human |
CD40 mouse monoclonal antibody, clone B-B20, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, FITC
| Applications | FC |
| Reactivities | Human |
| Conjugation | FITC |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, Purified
| Applications | FC |
| Reactivities | Human |
CD40L (CD40LG) mouse monoclonal antibody, clone B-B29, PE
| Applications | FC |
| Reactivities | Human |
| Conjugation | PE |
Active filters
Families
- Secreted Protein
Pathways
- Primary immunodeficiency