Primary Antibodies

View as table Download

Rabbit polyclonal antibody to PLA2G3 (phospholipase A2, group III)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 263 and 502 of PLA2G3 (Uniprot ID#Q9NZ20)

USD 300.00

In Stock

Goat Polyclonal Anti-VEGFA Antibody

Applications IF, WB
Reactivities Canine, Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen Purified recombinant human VEGFA isoform 6 produced in E. coli.

Anti-VEGFA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a region derived from 23-36 amino acids of human vascular endothelial growth factor A

Rabbit monoclonal antibody against VEGF (C-term)(EP1176Y)

Applications FC, IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit anti-VEGFA Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human VEGFA

Rabbit Polyclonal Anti-PLA2G5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the middle region of human PLA2G5. Synthetic peptide located within the following region: YRFAWGVVTCEPGPFCHVNLCACDRKLVYCLKRNLRSYNPQYQYFPNILC

Rabbit Polyclonal Anti-VEGF Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-VEGF Antibody: Synthetic peptide corresponding to a region derived human vascular endothelial growth factor A

PLA2G2D (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 112-138 amino acids from the C-terminal region of human PLA2G2D

Rabbit Polyclonal Antibody against VEGFA

Applications WB
Reactivities Human, Mouse, Dog, Horse, Cow, Rat, Chicken, Guinea Pig
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of the human VEGFA protein sequence (between residues 150-250). [Swiss-Prot# P15692]

Mouse Monoclonal VEGF Antibody (VG76e)

Applications IHC, WB
Reactivities Human, Bovine, Porcine, Sheep
Conjugation Unconjugated

Rabbit Polyclonal Anti-PLA2G5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G5 antibody: synthetic peptide directed towards the N terminal of human PLA2G5. Synthetic peptide located within the following region: MKGLLPLAWFLACSVPAVQGGLLDLKSMIEKVTGKNALTNYGFYGCYCGW

Rabbit Polyclonal Antibody against VEGFA (N-term)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This VEGF1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-95 amino acids from the N-terminal region of human VEGF1.

VEGFA (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence near the N-teminal end of VEGFA (aa 33-48 of Human origin.

PLA2G12A (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 54-83 amino acids from the Central region of human PLA2G12A

Rabbit polyclonal antibody to Phospholipase A2 XIIA (phospholipase A2, group XIIA)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 22 and 115 of PLA2G12A (Uniprot ID#Q9BZM1)

Mouse Monoclonal VEGF Antibody (VG1)

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine
Conjugation Unconjugated

PLA2G5 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 102-132aa) of human PLA2G5.

VEGFA (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 147-176 amino acids from the Central region of human VEGFA

Goat Polyclonal Antibody against PLA2G1B

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence NKAHKNLDTKKYCQS, from the C Terminus of the protein sequence according to NP_000919.1.

Goat Anti-VEGFA (aa288-299) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RIKPHQGQHIGE, from the internal region of the protein sequence according to NP_001020537.2; NP_003367.4; NP_001020538.2; NP_001020539.2; etc..

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Human
Immunogen PLA2G3 antibody was raised against synthetic 16 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Dog, Hamster (94%); Elephant, Panda, Rabbit (88%); Bovine, Horse, Pig (81%).

PLA2G3 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Gorilla, Human, Monkey, Pig
Conjugation Unconjugated
Immunogen PLA2G3 antibody was raised against synthetic 12 amino acid peptide from internal region of human PLA2G3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Elephant, Panda, Pig (100%); Mouse, Horse, Rabbit (92%); Bat, Dog, Opossum (83%).

Anti-Human VEGF Goat Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human VEGF

Anti-Human VEGF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human VEGF

Rabbit Polyclonal Anti-PLA2G12B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLA2G12B Antibody is: synthetic peptide directed towards the N-terminal region of Human PLA2G12B. Synthetic peptide located within the following region: LVLWLSLGGGLAQSDTSPDTEESYSDWGLRHLRGSFESVNSYFDSFLELL

Rabbit Polyclonal Anti-PLA2G3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G3 antibody is: synthetic peptide directed towards the C-terminal region of Human PLA2G3. Synthetic peptide located within the following region: QRRHQLQDKGTDERQPWPSEPLRGPMSFYNQCLQLTQAARRPDRQQKSWS

Rabbit Polyclonal Anti-PLA2G2E Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP

Mouse monoclonal Anti-VEGF Clone VG76e

Reactivities Human ; Mouse ; Primate

Mouse anti Vacular Endothelial Growth Factor(VEGF) Monoclonal Antibody

Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) VEGF mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)

Applications WB
Reactivities Human, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) VEGF mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) VEGF mouse monoclonal antibody, clone OTI4E3 (formerly 4E3)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) VEGFA mouse monoclonal antibody, clone OTI2B9 (formerly 2B9)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) VEGFA mouse monoclonal antibody, clone OTI15C8 (formerly 15C8)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) VEGFA mouse monoclonal antibody, clone OTI1A6 (formerly 1A6)

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) VEGFA mouse monoclonal antibody,clone OTI2E11

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI1F4

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI4F2

Applications WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PLA2G3 mouse monoclonal antibody,clone OTI8G8

Applications WB
Reactivities Human
Conjugation Unconjugated

Anti-VEGFA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 130-143 amino acids of human vascular endothelial growth factor A

Anti-VEGFA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 130-143 amino acids of human vascular endothelial growth factor A

VEGFA (VEGF) mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)

Applications WB
Reactivities Human, Dog
Conjugation Unconjugated

VEGFA (VEGF) mouse monoclonal antibody, clone OTI4G3 (formerly 4G3)

Applications WB
Reactivities Human, Dog
Conjugation Unconjugated

Anti-VEGFA (VEGF) mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)

Applications WB
Reactivities Human
Conjugation Unconjugated

VEGF mouse monoclonal antibody,clone 2F7, Biotinylated

Applications WB
Reactivities Human
Conjugation Biotin

VEGF mouse monoclonal antibody,clone 2F7, HRP conjugated

Applications WB
Reactivities Human
Conjugation HRP

Anti-VEGFA (VEGF) mouse monoclonal antibody, clone OTI2F7 (formerly 2F7)

Applications WB
Reactivities Human
Conjugation Unconjugated

VEGFA (VEGF) mouse monoclonal antibody, clone OTI4E3 (formerly 4E3)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated