Rabbit Polyclonal Anti-PPARA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPARA antibody: synthetic peptide directed towards the middle region of human PPARA. Synthetic peptide located within the following region: SEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVI |
Rabbit Polyclonal Anti-RXRB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRB antibody: synthetic peptide directed towards the N terminal of human RXRB. Synthetic peptide located within the following region: PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA |
Rabbit Polyclonal Anti-RXRG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG. Synthetic peptide located within the following region: NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH |
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRA antibody: synthetic peptide directed towards the N terminal of human RXRA. Synthetic peptide located within the following region: DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPI |
Rabbit Polyclonal Anti-RXRA Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRA antibody: synthetic peptide directed towards the C terminal of human RXRA. Synthetic peptide located within the following region: MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ |
Rabbit Polyclonal Anti-RXRG Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG. Synthetic peptide located within the following region: GSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLP |
Rabbit Polyclonal Anti-NR1H3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NR1H3 antibody: synthetic peptide directed towards the C terminal of human NR1H3. Synthetic peptide located within the following region: IHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWD |
Rabbit anti PPAR-gamma Polyclonal Antibody
| Reactivities | Human |
Rabbit anti PPARa Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti PPARb Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The full-length recombinant protein of human PPAR-beta. |
Rabbit anti PPARg Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti PPARd Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NR1H3 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-PPARA rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-18 amino acids of Human peroxisome proliferator-activated receptor alpha |
Anti-PPARG Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-15 amino acids of Human peroxisome proliferator-activated receptor gamma |
Anti-PPARD Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1-14 amino acids of human peroxisome proliferator-activated receptor delta |
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Germany
Japan
United Kingdom
China
