Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal ETV6 Antibody (N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ETV6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 84-111 amino acids from the N-terminal region of human ETV6. |
Rabbit monoclonal antibody against ETS1(clone EPR546(2))
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ETS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETS1 antibody: synthetic peptide directed towards the N terminal of human ETS1. Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN |
Rabbit Polyclonal Anti-ETV6 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETV6 antibody: synthetic peptide directed towards the C terminal of human ETV6. Synthetic peptide located within the following region: VSVSPPEEHAMPIGRIADCRLLWDYVYQLLSDSRYENFIRWEDKESKIFR |
Anti-ETS1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 209 amino acids of human v-ets erythroblastosis virus E26 oncogene homolog 1 (avian) |
Rabbit Polyclonal anti-ETS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ETS1 antibody is: synthetic peptide directed towards the middle region of Human ETS1. Synthetic peptide located within the following region: FQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNG |
Rabbit Polyclonal Anti-ETV6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETV6 antibody: synthetic peptide directed towards the N terminal of human ETV6. Synthetic peptide located within the following region: WAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHIL |
Rabbit Polyclonal Anti-ETV7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ETV7 Antibody: synthetic peptide directed towards the N terminal of human ETV7. Synthetic peptide located within the following region: SLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRAL |
Rabbit Polyclonal Anti-ETV7 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETV7 antibody: synthetic peptide directed towards the C terminal of human ETV7. Synthetic peptide located within the following region: IIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEIS |
Rabbit Polyclonal Anti-ETS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the N terminal of human ETS2. Synthetic peptide located within the following region: NDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQE |
Rabbit Polyclonal Anti-ETS2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ETS2 antibody: synthetic peptide directed towards the middle region of human ETS2. Synthetic peptide located within the following region: DPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTSGKRYVYRFVC |
Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETS2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ETV7 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-ETS2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human ETS2 |
ETS2 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody,clone 3E10, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ETS2 mouse monoclonal antibody,clone 3E10, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ETS2 mouse monoclonal antibody, clone OTI3E10 (formerly 3E10)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ETS2 mouse monoclonal antibody, clone OTI1H4 (formerly 1H4)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ETS2 mouse monoclonal antibody, clone OTI2A3 (formerly 2A3)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ETS2 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody,clone 3B9, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ETS2 mouse monoclonal antibody,clone 3B9, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ETS2 mouse monoclonal antibody, clone OTI3B9 (formerly 3B9)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ETS2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
ETS2 mouse monoclonal antibody,clone 3C4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
ETS2 mouse monoclonal antibody,clone 3C4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
ETS2 mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
ETV7 mouse monoclonal antibody,clone 3B2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
ETV7 mouse monoclonal antibody,clone 3B2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
ETV7 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
ETV7 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Families
- Transcription Factors
Pathways
- Dorso-ventral axis formation