Primary Antibodies

View as table Download

Rabbit polyclonal anti-ABCC3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCC3.

ABCC4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4

Mouse Monoclonal ABCG2/CD338 Antibody (3G8)

Applications ELISA, FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Goat Polyclonal Antibody against ABCC4

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2.

Rabbit polyclonal anti-ABCC2 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCC2.

Rabbit Polyclonal Anti-ABCB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the N terminal of human ABCB4. Synthetic peptide located within the following region: AGAVAEEALGAIRTVIAFGGQNKELERYQKHLENAKEIGIKKAISANISM

Rabbit Polyclonal Anti-CFTR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CFTR antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CFTR.

Rabbit polyclonal antibody to ABCD2 (ATP-binding cassette, sub-family D (ALD), member 2)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 338 and 588 of ABCD2 (Uniprot ID#Q9UBJ2)

TAP2 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TAP2

Goat Polyclonal Antibody against ABCC8

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EFDKPEKLLSRKD, from the C Terminus of the protein sequence according to NP_000343.2.

Rabbit Monoclonal antibody against PMP70

Applications Assay, FC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ABCG2(CD338) Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCG2(CD338) Antibody: Peptide sequence around aa.160~164( R-I-N-R-V) derived from Human ABCG2(CD338).

Mouse Monoclonal MRP1 Antibody (IU5C1)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated

Mouse anti-ABCA1 monoclonal antibody

Applications WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated

Rabbit Polyclonal Anti-CFTR

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KEETEEEVQDTRL, corresponding to amino acid residues 1468-1480 of human CFTR . Cytoplasmic, C-terminal part.

Mouse Anti-ABCA4 (Rim Protein) Antibody

Applications IHC
Reactivities Bovine, Human, Mouse, Xenopus
Conjugation Unconjugated

Mouse Monoclonal ABCA1 Antibody (HJ1) - Astrocyte Marker

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-ABCB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCB4 antibody: synthetic peptide directed towards the middle region of human ABCB4. Synthetic peptide located within the following region: GRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQLLAQKGIYFSMVSV

Rabbit anti-ABCD3 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from human ABCD3.

Rabbit Polyclonal Anti-ABCG5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCG5 Antibody: synthetic peptide directed towards the middle region of human ABCG5. Synthetic peptide located within the following region: CGYPCPEHSNPFDFYMDLTSVDTQSKEREIETSKRVQMIESAYKKSAICH

Goat Polyclonal Antibody against ABCB5

Applications FC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QTQHRNTSKKAQ, from the internal region of the protein sequence according to NP_848654.3.

Rabbit Polyclonal ABCA1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Hamster
Conjugation Unconjugated
Immunogen Partial peptide sequence (peptide used resides somewhere between a.a 1100-1300) of the human ABCA1 gene. Actual immunogen sequence is proprietary information.

Goat Polyclonal Antibody against ABCC5

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence KDIDIGKEYIIP-C, from the N Terminus of the protein sequence according to NP_005679.2; NP_001018881.1.

Goat Anti-ABCC1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQSDLKVDENQKAYY, from the internal region of the protein sequence according to NP_004987.2; NP_063915.2; NP_063953.2;NP_063954.2; NP_063955.2.

Rabbit Polyclonal Anti-ABCA12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCA12 Antibody: synthetic peptide directed towards the middle region of human ABCA12. Synthetic peptide located within the following region: TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV

Rabbit Polyclonal Anti-ABCB6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABCB6 antibody: synthetic peptide directed towards the middle region of human ABCB6. Synthetic peptide located within the following region: VTEWRTKFRRAMNTQENATRARAVDSLLNFETVKYYNAESYEVERYREAI

Rabbit Polyclonal ABCB5 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human ABCB5 protein (between residues 450-500) [UniProt Q2M3G0]

Rabbit polyclonal anti-ABCB10 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCB10.

Rabbit polyclonal anti-ABCD4 antibody

Applications WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCD4.

Rabbit polyclonal anti-ABCD1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCD1.

Rabbit polyclonal anti-ABCB7 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCB7.

Rabbit polyclonal anti-ABCA8 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCA8.

Rabbit polyclonal anti-ABCA6 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human ABCA6.

Rabbit polyclonal anti-ABCA13 antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCA13.

Rabbit polyclonal anti-ABCB1 antibody

Applications WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 262-277 of human ABCB1 protein.

Anti-ABCG1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 349-362 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 1

Rabbit Polyclonal Anti-TAP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Rabbit Polyclonal Anti-ABCC8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW

Rabbit Polyclonal ABCG1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human ABCG1 (between residues 300-400). [UniProt# P45844]

Mouse Monoclonal ABCG5 Antibody (1B5E10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal ABCB5 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal ABCA8 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal ABCG2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal ABCG2 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Goat Anti-ABCD4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RDDIDNPDQRISQD, from the internal region of the protein sequence according to NP_005041.1.

Goat Anti-ABCD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EDMQRKGYSEQD, from the internal region of the protein sequence according to NP_000024.2.

Goat Anti-ABCA9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRVVQELEMENIQD, from the internal region of the protein sequence according to NP_525022.2.

Goat Anti-MRP8 / ABCC11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KVVEFDRPEVLRK, from the internal region (near C Terminus) of the protein sequence according to NP_115972.2; NP_660187.1.

Rabbit Polyclonal ABCG8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide from the N-terminal region of human ABCG8 protein.

Rabbit anti-ABCB8 polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human ABCB8.