Rabbit Monoclonal antibody against Gli-1 (GLI1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Monoclonal antibody against Gli-1 (GLI1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit polyclonal EGFR (Ab-1172) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit Polyclonal Gli1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151] |
BMP2 (aa 261-290) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 261-290 of Human BMP2. |
Rabbit Polyclonal Anti-WNT3A Antibody - C-terminal region
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Wnt3a antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: IGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEA |
Rabbit Polyclonal Anti-WNT3A Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT3A antibody: synthetic peptide directed towards the N terminal of human WNT3A. Synthetic peptide located within the following region: MAPLGYFLLLCSLKQALGSYPIWWSLAVGPQYSSLGSQPILCASIPGLVP |
BMP4 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Chicken, Human, Mouse, Rabbit, Rat |
Immunogen | Synthetic peptide surrounding amino acid 395 of Human BMP-4 |
Rabbit polyclonal SMAD3-S208 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This SMAD3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 186-215 amino acids from human SMAD3. |
Rabbit polyclonal anti-Gli-3 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Chimpanzee, Squirrel Monkey, Xenopus, Chicken, Dog |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was produced from monospecific rabbit serum by repeated immunizations with a synthetic peptide corresponding to amino acids 41-57 of human Gli-3 protein. |
Rabbit Polyclonal Anti-WNT5A Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT5A antibody: synthetic peptide directed towards the middle region of human WNT5A. Synthetic peptide located within the following region: GGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRT |
Rabbit Polyclonal BMP-2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal region of human BMP2 (within residues 250-350) [Swiss-Prot# P12643] |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
Modifications | Phospho-specific |
Rabbit polyclonal SMAD3 phospho S423/phospho S425 antibody
Applications | IHC, WB |
Reactivities | Human, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 417-425 of human SMAD3 protein. |
Anti-SMAD3 (Phospho-Ser425) Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around phosphorylation site of serine 425 (C-S-S-V-S(p)) derived from Human Smad3. |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-GLI2 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GLI2 antibody: synthetic peptide directed towards the N terminal of human GLI2. Synthetic peptide located within the following region: RNDVHLRTPLLKENGDSEAGTEPGGPESTEASSTSQAVEDCLHVRAIKTE |
Rabbit Polyclonal Anti-WNT7B Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-WNT7B antibody: synthetic peptide directed towards the middle region of human WNT7B. Synthetic peptide located within the following region: WTTLPKFREVGHLLKEKYNAAVQVEVVRASRLRQPTFLRIKQLRSYQKPM |
SMAD2 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal Smad3 (Ab-204) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Smad3 around the phosphorylation site of serine 204 (A-G-SP-P-N). |
Rabbit polyclonal anti-WNT1 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human WNT1. |
Rabbit polyclonal anti-EGFR antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR. |
Rabbit polyclonal EGFR-S1026 Antibody (C-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026. |
Rabbit polyclonal EGFR Antibody (S1070)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This EGFR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1048-1077 amino acids from human EGFR. |
Rabbit Polyclonal GLI-2 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an internal portion of the human Gli2 protein (between residues 300-400) [UniProt P10070] |
Rabbit Polyclonal Wnt-5a Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids 190-230 of human Wnt5A was used as the immunogen for this antibody, GenBank no NP_003383.2. |
SMAD3 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
SMAD2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
EGFR pTyr1197 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
SMAD2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to the N-terminal of human SMAD2/3 |
Rabbit anti-SMAD3 (Phospho-Ser425) polyclonal antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antibody was produced against synthesized phosphopeptide derived from humanSmad3 around the phosphorylation site of serine 425 (C-S-S-V-SP). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-GLI-3 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human GLI-3. |
Rabbit polyclonal anti-SMAD3 antibody
Applications | IHC, WB |
Reactivities | Human, Xenopus, Xenopus Tropicalis, Zebrafish, Rat, Mouse, Swine, Bovine, Chicken |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to the C-terminal domain of human SMAD3 protein. |
Rabbit polyclonal EGFR phospho Y1197 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1189-1199 of human EGFR protein. |
Anti-SMAD2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.218~222 (P-E-T-P-P) derived from Human Smad2. |
Anti-SMAD3 Rabbit Polyclonal Antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide sequence around aa.423~427 (C-S-S-V-S) derived from Human Smad3. |
Rabbit polyclonal EGFR (ErbB1) Antibody (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EGFR (ErbB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human EGFR (ErbB1). |
Rabbit polyclonal EGFR Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This EGFR antibody is generated from rabbits immunized with EGFR his fusion protein. |
Rabbit Polyclonal Smad2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat, Bovine, Canine, Chicken, Primate |
Conjugation | Unconjugated |
Immunogen | Amino acids 234-249 (DQQLNQSMDTGSPAEL) of human SMAD2 protein was used as the immunogen. |
Von Willebrand Factor (VWF) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Human |
Immunogen | Purified Factor VIII related antigen / von Willebrand Factors. |
EGFR pTyr1092 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Rat |
EGFR pTyr1172 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR pTyr1197 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR pTyr869 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR pTyr1110 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
EGFR rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human, Mouse, Rat |
WNT6 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Bat, Gibbon, Bovine, Dog, Gorilla, Horse, Human, Rabbit |
Conjugation | Unconjugated |
Immunogen | WNT6 antibody was raised against synthetic 18 amino acid peptide from internal region of human WNT6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Elephant, Bovine, Dog, Bat, Horse, Rabbit, Opossum (100%); Marmoset, Mouse, Rat, Hamster, Platypus (94%); Turkey, Chicken (83%). |