Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit polyclonal IGF1R (Tyr1346) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
PDGF Receptor alpha (PDGFRA) (1035-1053) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide KLH-conjugated corresponding to amino acids 1000 to the C-term of Human PDGF |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit polyclonal IGF1R (Ab-1346) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal HER2 (Tyr877) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HER2 around the phosphorylation site of Tyrosine 877 (T-E-YP-H-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal ERBB2 Antibody(N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERBB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 21-52 amino acids from the N-terminal region of human ERBB2. |
Rabbit polyclonal PDGFRB Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PDGFRB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-72 amino acids from the N-terminal region of human PDGFRB. |
Rabbit polyclonal HER2 (Tyr1248) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | HER2 (phospho-Tyr1248) antibody detects endogenous levels of HER2 only when phosphorylated at tyrosine 1248. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-EGFR antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR. |
Rabbit polyclonal EGFR-S1026 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026. |
Rabbit anti-IGF1R polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from humanIGF-1R around the phosphorylation site of tyrosine 1161 (D-I-YP-E-T). |
Bcl-2 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Immunogen | BCL2 / Bcl-2 antibody was raised against synthetic peptide from human BCL-2 (aa46-95). |
Rabbit polyclonal EGFR phospho Y1197 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1189-1199 of human EGFR protein. |
Rabbit polyclonal EGFR (ErbB1) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EGFR (ErbB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human EGFR (ErbB1). |
Anti-Human TGF-a Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human TGF-α |
Phospho-BCL2-S70 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S70 of human BCL2 |
| Modifications | Phospho-specific |
Phospho-BCL2-T56 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T56 of human BCL2 |
| Modifications | Phospho-specific |
Rabbit anti BCL-2 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to aa 41-54 of human BCL-2 alpha. |
Rabbit anti FGFR-2 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide from aa 362-374 of human FGFR-2 protein. |
Rabbit anti FGFR-1 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | A synthetic peptide from internal sequence of human FGFR-1 protein. This sequence is identical to mouse and rat. |
Anti-FGFR2 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 809-821 amino acids of Human Fibroblast growth factor receptor 2 |
Anti-TGFA Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 24-98 amino acids of human transforming growth factor, alpha |
Anti-FGFR1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to C terminal 200 amino acids of human fibroblast growth factor receptor 1 |
Anti-EGF Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 926-1026 amino acids of human epidermal growth factor |
Rabbit Monoclonal BCL2 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
