HK1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK1 |
HK1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK1 |
Rabbit Polyclonal Anti-TSTA3 Antibody - N-terminal region
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TSTA3 antibody: synthetic peptide directed towards the N terminal of human TSTA3. Synthetic peptide located within the following region: MGEPQGSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD |
Rabbit anti-HK2 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HK2 |
Rabbit Polyclonal Anti-GMPPB Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GMPPB antibody: synthetic peptide directed towards the C terminal of human GMPPB. Synthetic peptide located within the following region: RCRVGQWVRMENVTVLGEDVIVNDELYLNGASVLPHKSIGESVPEPRIIM |
Rabbit polyclonal anti-GNE antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human GNE. |
GNPDA1 (C-term) rabbit polyclonal antibody
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide - KLH conjugated |
GNPDA2 (C-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | Synthetic peptide - KLH conjugated |
Rabbit polyclonal GCK Antibody (N-term)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This GCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human GCK. |
CYB5R3 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
GFPT2 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 181~210 amino acids from the Center region of human GFPT2 / GFAT2 |
Rabbit polyclonal antibody to UAP1 (UDP-N-acteylglucosamine pyrophosphorylase 1)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 53 and 473 of UAP1 |
Rabbit polyclonal antibody to FPGT (fucose-1-phosphate guanylyltransferase)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 146 and 453 of FPGT (Uniprot ID#O14772) |
Rabbit polyclonal anti-HEXB antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human HEXB. |
GLCNE (GNE) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 168-197 amino acids from the N-terminal region of Human GNE / GLCNE |
UDP glucose dehydrogenase (UGDH) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 464-494 amino acids from the C-terminal region of human UGDH |
Rabbit polyclonal antibody to NANS (N-acetylneuraminic acid synthase)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 54 and 359 of NANS (Uniprot ID#Q9NR45) |
Rabbit polyclonal antibody to MPI (mannose phosphate isomerase)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 150 and 423 of MPI (Uniprot ID#P34949) |
Rabbit Polyclonal antibody to PMM2 (phosphomannomutase 2)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 214 of PMM2 (Uniprot ID#O15305) |
Rabbit polyclonal antibody to GMDS (GDP-mannose 4,6-dehydratase)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 67 and 357 of GMDS (Uniprot ID#O60547) |
Rabbit polyclonal anti-CYB5R3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYB5R3. |
Modifications | Phospho-specific |
Rabbit polyclonal HK2 (Hexokinase II) Antibody (N-term)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HK2 (Hexokinase II) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 91-121 amino acids from the N-terminal region of human HK2 (Hexokinase II). |
Rabbit Polyclonal Anti-HK2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HK2 Antibody: synthetic peptide directed towards the N terminal of human HK2. Synthetic peptide located within the following region: GTEHGEFLALDLGGTNFRVLWVKVTDNGLQKVEMENQIYAIPEDIMRGSG |
Rabbit Polyclonal GNPDA1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A portion of amino acids 100-150 of human GNPDA1 was used as the immunogen for the antibody. |
Rabbit Polyclonal Anti-GFPT1 Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | GFPT1 / GFAT antibody was raised against synthetic 12 amino acid peptide from N-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Panda, Bovine, Dog, Bat, Horse, Pig, Opossum, Guinea pig, Zebra finch, Chicken (100%); Turkey, Platypus (92%). |
Rabbit Polyclonal Anti-HEXA Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HEXA antibody: synthetic peptide directed towards the C terminal of human HEXA. Synthetic peptide located within the following region: WKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNLVPRLWPRAGAV |
Rabbit Polyclonal Anti-NANP Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | NANP antibody was raised against synthetic 16 amino acid peptide from near N-terminus of human NANP. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Bat (100%); Hamster, Pig (94%); Elephant, Panda, Dog, Rabbit (88%); Turkey, Chicken (81%). |
Rabbit Polyclonal Anti-NANP Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | NANP antibody was raised against synthetic 16 amino acid peptide from internal region of human NANP. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Mouse, Rat, Dog, Hamster, Panda, Rabbit (100%); Marmoset, Bovine, Elephant, Pig, Opossum, Turkey, Chicken, Platypus (94%); Bat (88%); Lizard (81%). |
Rabbit Polyclonal Anti-NANP Antibody (N-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | NANP antibody was raised against synthetic 16 amino acid peptide from N-terminus of human NANP. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Rat, Bovine, Bat, Hamster, Panda, Pig (88%); Mouse, Dog, Elephant, Turkey, Chicken, Platypus (81%). |
Rabbit Polyclonal Anti-NANP Antibody (Internal)
Applications | IHC |
Reactivities | Human |
Immunogen | NANP antibody was raised against synthetic 16 amino acid peptide from internal region of human NANP. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Rabbit (100%); Dog, Panda, Pig (94%); Bovine (88%); Bat (81%). |
Rabbit Polyclonal Anti-GFPT1 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Immunogen | GFPT1 / GFAT antibody was raised against synthetic 14 amino acid peptide from C-Terminus of human GFPT1. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Bovine, Horse, Pig, Opossum, Guinea pig (100%); Dog, Bat (93%); Turkey, Zebra finch, Chicken (86%). |
Anti-GCK Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 3-17 amino acids of Human glucokinase (hexokinase 4) |
Anti-GCK Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 3-17 amino acids of Human glucokinase (hexokinase 4) |
Anti-AMDHD2 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human amidohydrolase domain containing 2 |
Anti-AMDHD2 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human amidohydrolase domain containing 2 |
Rabbit Polyclonal Anti-HK3 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HK3 |
Rabbit Polyclonal Anti-HK2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HK2 |
Rabbit Polyclonal Anti-HK1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HK1 |
Rabbit Polyclonal Anti-GALK1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GALK1 |
Rabbit Polyclonal Anti-GALT Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GALT |
Rabbit Polyclonal Anti-GCK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human GCK |
Rabbit Polyclonal Anti-UGP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human UGP2 |