Antibodies

View as table Download

Rabbit anti-STAT1 (Phospho-Tyr701) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT1 around the phosphorylation site of tyrosine 701 (T-G-YP-I-K).
Modifications Phospho-specific

Rabbit Polyclonal IFN-beta Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta.

Rabbit Polyclonal Anti-IFNG Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human IFNG

Rabbit Polyclonal Anti-IRF9 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IRF9

Rabbit Polyclonal Anti-SOCS1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA

Rabbit Polyclonal Anti-IL20RA Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human IL20RA

Rabbit Polyclonal Anti-GRB2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Rabbit anti-STAT3 (Phospho-Tyr705) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT3 around the phosphorylation site of tyrosine 705 (A-P-YP-L-K).
Modifications Phospho-specific

Rabbit Polyclonal Anti-CDK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CDK2

Rabbit Polyclonal Anti-IL-12A Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen IL-12A antibody was raised against an 18 amino acid peptide near the carboxy terminus of human IL-12A. The immunogen is located within the last 50 amino acids of IL-12A.

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

Rabbit polyclonal JAK1 (Ab-1022) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human JAK1 around the phosphorylation site of tyrosine 1022.

IL23R Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IL23R

Rabbit Polyclonal Antibody against PIK3CA (Center)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 504-533 amino acids from the Central region of human PI3KCA.

Rabbit Polyclonal Anti-SOCS2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human SOCS2

Rabbit Monoclonal antibody against IL-11R alpha (IL11RA)

Applications Assay, FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal STAT6 (Ab-641) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human STAT6 around the phosphorylation site of Tyrosine 641.

CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCND1

Anti-Human Leptin Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Leptin

Phospho-STAT6-Y641 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y641 of human STAT6
Modifications Phospho-specific

Rabbit Polyclonal Anti-CSH1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CSH1 antibody: synthetic peptide directed towards the middle region of human CSH1. Synthetic peptide located within the following region: SMFANNLVYDTSDSDDYHLLKDLEEGIQTLMGRLEDGSRRTGQILKQTYS

Rabbit Polyclonal Anti-LEP Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LEP antibody: synthetic peptide directed towards the N terminal of human LEP. Synthetic peptide located within the following region: MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQS

Rabbit Polyclonal Anti-JAK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen JAK2 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human JAK2.

Rabbit Polyclonal Anti-IL3RA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL3RA

PIM1 Antibody (C-term ) Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PIM1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 374-404 amino acids from the C-terminal region of human PIM1.

Rabbit Polyclonal antibody to SOCS5 (suppressor of cytokine signaling 5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide contain a sequence corresponding to a region within amino acids 1 and 42 of SOCS5

Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K).
Modifications Phospho-specific

Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C).
Modifications Phospho-specific

Rabbit anti-EPO Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human EPO

Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1.

Rabbit Polyclonal Antibody against AKT2 (N-term)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2.

Rabbit Polyclonal IL-21 Receptor Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-21 receptor antibody was raised against a synthetic peptide corresponding to amino acids 97 to 111 of human IL-21 receptor precursor. The immunogen is located within amino acids 80 - 130 of IL-21 Receptor.

Rabbit Polyclonal Akt1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1.

Rabbit polyclonal IL-9R (Ser519) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human IL-9R around the phosphorylation site of serine 519 (A-R-SP-W-T).
Modifications Phospho-specific

Rabbit anti-AKT1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human AKT1

Rabbit anti-IFNGR1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IFNGR1

Phospho-BCL2L1-S62 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S62 of human BCL2L1
Modifications Phospho-specific

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Prolactin Receptor Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal Akt (Ab-129) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A).

Rabbit polyclonal Akt (Ab-326) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R).

Rabbit polyclonal Cyclin D3 (Thr283) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Cyclin D3 around the phosphorylation site of threonine 283 (T-S-TP-P-T).
Modifications Phospho-specific

Rabbit polyclonal anti-CREB-BP antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human CREB-BP.

Rabbit polyclonal anti-JAK1 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human JAK1.

IL-21 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen IL21 antibody was raised against a synthetic peptide corresponding to 15 amino acids near the center of human IL-21 precursor .

Rabbit Polyclonal PIAS3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen PIAS3 antibody was raised against a 12 amino acid synthetic peptide near the carboxy terminus of human PIAS3.

Rabbit polyclonal STAT3 (Ab-705) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human STAT3 around the phosphorylation site of tyrosine 705.

Rabbit Polyclonal IL-22 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen IL-22 antibody was raised against a 17 amino acid peptide near the center of human IL-22

Rabbit anti-IL-6R Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human IL-6R