Antibodies

View as table Download

Phospho-RAC1-S71 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S71 of human RAC1

Rabbit Polyclonal Bax Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Monoclonal Antibody against CASP3 (Clone E87)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit anti-CYCS Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CYCS

Rabbit Anti-NMDA NR2B Subunit Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein from the C-terminal region of the NR2B subunit

Rabbit polyclonal Caspase 9 (Cleaved-Asp315) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 9.

CASP3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human CASP3

Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K).
Modifications Phospho-specific

CASP3 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CASP3

Rabbit anti-SOD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SOD1

Rabbit anti-TNF-R1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNF-R1

Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B)

Phospho-NOS3-S1177 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S1177 of human NOS3
Modifications Phospho-specific

Rabbit Polyclonal ASK1 Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ASK1 antibody was raised against a 16 amino acid peptide from near the carboxy terminus of human ASK1.

Rabbit Anti-p38 MAPK (Thr180/Tyr182) Antibody (Phospho-Specific)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic phospho-peptide corresponding to amino acid residues surrounding Thr180/Tyr182 conjugated to KLH
Modifications Phospho-specific

Rabbit polyclonal anti-iNOS antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human iNOS.

Bax Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human Bax

Anti-Human sTNF Receptor Type I Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type I

Rabbit Polyclonal p53 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-p53 antibody: human p53 (tumor protein p53), using a KLH-conjugated synthetic peptide containing a sequence from the C-terminal part of the protein.

Rabbit polyclonal APAF-1-ALT antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human APAF-1-ALT.

Rabbit anti-RAB5A Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RAB5A

BCL2 Rabbit Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Rat, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human BCL2

Rabbit Monoclonal Antibody against BAD (Clone Y208)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Rabbit Polyclonal ASK1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen ASK1 antibody was raised against a 16 amino acid peptide from near the amino terminus of human ASK1.

Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 3.

Rabbit Polyclonal GluR1 Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GluR1

PPP3CA Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP3CA

Rabbit anti-MAP2K6 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAP2K6

Rabbit Polyclonal Anti-SOD1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SOD1 antibody is: synthetic peptide directed towards the C-terminal region of Human SOD1. Synthetic peptide located within the following region: DVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLA

Rabbit Polyclonal Anti-RAC1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAC1 antibody: synthetic peptide directed towards the middle region of human RAC1. Synthetic peptide located within the following region: LAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

Rabbit Monoclonal Antibody against CASP3 (Clone E83-103)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P).
Modifications Phospho-specific

Rabbit anti-NOS2A polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide derived from Human NOS2A.

Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L).
Modifications Phospho-specific

Rabbit polyclonal p38 MAPK (Ab-322) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q).

Rabbit Monoclonal Antibody against DAXX (Clone E94)

Applications FC, IHC, WB
Reactivities Human

Rabbit Polyclonal Antibody against Derlin-1

Applications IHC, WB
Reactivities Human, Dog
Conjugation Unconjugated
Immunogen A synthetic peptide made to the C-terminal region of the human Derlin-1 protein sequence (between residues 200-251).

Rabbit Polyclonal Caspase-1 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Caspase-1 antibody was raised against a 15 amino acid peptide from near the middle of human Caspase-1.

Rabbit polyclonal iNOS (Ab-151) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human iNOS around the phosphorylation site of tyrosine 151 (Q-Y-YP-G-S).

CASP1 Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CASP1

Rabbit anti-GRIA1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIA1

Phospho-BCL2L1-S62 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S62 of human BCL2L1
Modifications Phospho-specific

Cytochrome C (CYCS) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a sequence at the C-terminal of human Cytochrome C

Rabbit Polyclonal Bcl-2 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Bcl-2 antibody was raised against a peptide corresponding to 15 amino acids near the N-terminus of human Bcl-2.

Rabbit polyclonal anti-BAX antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human BAX.

Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125
Modifications Phospho-specific

Rabbit Polyclonal iNOS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human iNOS

Rabbit Polyclonal eNOS Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human eNOS.

BID Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BID

Rabbit anti-TP53 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TP53