Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit polyclonal Bi-Phospho-ERK1/2(T202/Y204) Antibody
| Applications | Dot, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERK1/2 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T202/Y204 of human ERK1/2. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Active filters
Category
-
Antibodies
- Primary Antibodies
Reactivities
- Human
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- Druggable Genome
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (25)
- MAPT (19)
- AKT1 (18)
- JUN (15)
- EZR (14)
- TP53 (14)
- ATF2 (13)
- BRCA1 (13)
- CD44 (13)
- NR3C1 (13)
- RELA (13)
- CHEK1 (12)
- BRAF (11)
- IRS1 (11)
- PDGFRB (11)
- PRKCD (11)
- CREB1 (10)
- FOXO1 (10)
- IKBKG (10)
- MET (10)
- PAK1 (10)
- SRC (10)
- ESR1 (9)
- FGFR1 (9)
- GRIN2B (9)
- MAPK14 (9)
- NFKB1 (9)
- RAF1 (9)
- RPS6KB1 (9)
- BRCA2 (8)
- CCNB1 (8)
- CDC25A (8)
- CHUK (8)
- CSF1R (8)
- ERBB2 (8)
- FN1 (8)
- GSK3A (8)
- IGF1R (8)
- JAK2 (8)
- MAP2K1 (8)
- MDM2 (8)
- NOS3 (8)
- PPP1R1B (8)
- PRKCA (8)
- PTK2 (8)
- RUNX1 (8)
- SNCA (8)
- STAT5A (8)
- ABL1 (7)
- BAD (7)
- CASP7 (7)
- CASP9 (7)
- CDK2 (7)
- CFLAR (7)
- CTNNB1 (7)
- EPHA2 (7)
- HDAC2 (7)
- MAP2K4 (7)
- MAPK3 (7)
- MTOR (7)
- NFKBIA (7)
- PTPN11 (7)
- RPS6KA5 (7)
- SMAD1 (7)
- STAT1 (7)
- SYK (7)
- AGT (6)
- APP (6)
- BCL2L1 (6)
- CASP3 (6)
- CCNE1 (6)
- DPYSL2 (6)
- ELK1 (6)
- GCG (6)
- HDAC1 (6)
- HDAC4 (6)
- HSPD1 (6)
- IKBKB (6)
- JUND (6)
- MAPK8 (6)
- MYB (6)
- PAK2 (6)
- POMC (6)
- PRKD1 (6)
- PXN (6)
- SHC1 (6)
- SMAD3 (6)
- STAT5B (6)
- TH (6)
- TNC (6)
- ADD1 (5)
- AFP (5)
- AHR (5)
- AKR1B1 (5)
- APAF1 (5)
- BAX (5)
- BMX (5)
- CAMK2A (5)
- CAMK2B (5)
- CASP8 (5)
Applications
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (774)
- MAPK signaling pathway (529)
- Focal adhesion (433)
- Metabolic pathways (380)
- Neurotrophin signaling pathway (360)
- Prostate cancer (354)
- Chemokine signaling pathway (330)
- Regulation of actin cytoskeleton (323)
- ErbB signaling pathway (319)
- Cytokine-cytokine receptor interaction (298)
- Chronic myeloid leukemia (292)
- Colorectal cancer (282)
- Pancreatic cancer (279)
- Neuroactive ligand-receptor interaction (267)
- T cell receptor signaling pathway (264)
- Insulin signaling pathway (260)
- Cell cycle (247)
- Apoptosis (239)
- Toll-like receptor signaling pathway (238)
- Glioma (232)
- Small cell lung cancer (230)
- Melanoma (228)
- Calcium signaling pathway (221)
- Acute myeloid leukemia (216)
- GnRH signaling pathway (210)
- Progesterone-mediated oocyte maturation (210)
- Jak-STAT signaling pathway (208)
- B cell receptor signaling pathway (207)
- Wnt signaling pathway (203)
- Endocytosis (200)
- Non-small cell lung cancer (198)
- Adipocytokine signaling pathway (194)
- Endometrial cancer (194)
- Epithelial cell signaling in Helicobacter pylori infection (192)
- Adherens junction (188)
- Natural killer cell mediated cytotoxicity (187)
- Fc gamma R-mediated phagocytosis (186)
- Axon guidance (182)
- Alzheimer's disease (181)
- Leukocyte transendothelial migration (179)
- Renal cell carcinoma (179)
- Fc epsilon RI signaling pathway (177)
- VEGF signaling pathway (172)
- Oocyte meiosis (171)
- Bladder cancer (167)
- p53 signaling pathway (164)
- Gap junction (156)
- Melanogenesis (154)
- NOD-like receptor signaling pathway (142)
- Vascular smooth muscle contraction (141)
- Amyotrophic lateral sclerosis (ALS) (139)
- Long-term potentiation (134)
- Huntington's disease (128)
- Tight junction (128)
- RIG-I-like receptor signaling pathway (117)
- TGF-beta signaling pathway (113)
- Long-term depression (111)
- mTOR signaling pathway (111)
- Type II diabetes mellitus (105)
- Hematopoietic cell lineage (97)
- Ubiquitin mediated proteolysis (94)
- Pathogenic Escherichia coli infection (89)
- Thyroid cancer (83)
- ECM-receptor interaction (81)
- Cell adhesion molecules (CAMs) (74)
- Dilated cardiomyopathy (72)
- Hypertrophic cardiomyopathy (HCM) (71)
- Complement and coagulation cascades (70)
- Cytosolic DNA-sensing pathway (70)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (65)
- Basal cell carcinoma (64)
- Viral myocarditis (61)
- Parkinson's disease (57)
- Dorso-ventral axis formation (56)
- Prion diseases (56)
- Phosphatidylinositol signaling system (55)
- Purine metabolism (54)
- Glycolysis / Gluconeogenesis (53)
- Olfactory transduction (48)
- PPAR signaling pathway (48)
- Notch signaling pathway (45)
- Vibrio cholerae infection (45)
- ABC transporters (44)
- Lysosome (42)
- Drug metabolism - cytochrome P450 (41)
- Metabolism of xenobiotics by cytochrome P450 (41)
- Arginine and proline metabolism (39)
- Primary immunodeficiency (39)
- Glycerolipid metabolism (34)
- Homologous recombination (34)
- Hedgehog signaling pathway (33)
- Antigen processing and presentation (32)
- Systemic lupus erythematosus (32)
- Fructose and mannose metabolism (31)
- Retinol metabolism (31)
- Type I diabetes mellitus (31)
- Base excision repair (30)
- Pyruvate metabolism (28)
- Tyrosine metabolism (28)
- Arachidonic acid metabolism (27)
- Inositol phosphate metabolism (27)
- Nucleotide excision repair (27)
- Taste transduction (27)
- Renin-angiotensin system (25)
- Fatty acid metabolism (23)
- Mismatch repair (23)
- Pyrimidine metabolism (23)
- Tryptophan metabolism (23)
- Alanine (22)
- SNARE interactions in vesicular transport (22)
- aspartate and glutamate metabolism (22)
- Pentose phosphate pathway (21)
- Valine (21)
- Butanoate metabolism (20)
- Cardiac muscle contraction (20)
- Galactose metabolism (20)
- Nitrogen metabolism (20)
- DNA replication (19)
- leucine and isoleucine degradation (19)
- Androgen and estrogen metabolism (18)
- Autoimmune thyroid disease (18)
- Graft-versus-host disease (17)
- Histidine metabolism (17)
- Non-homologous end-joining (17)
- Allograft rejection (16)
- Amino sugar and nucleotide sugar metabolism (16)
- Cysteine and methionine metabolism (16)
- Citrate cycle (TCA cycle) (15)
- Glutathione metabolism (15)
- Glycerophospholipid metabolism (15)
- Regulation of autophagy (15)
- Drug metabolism - other enzymes (14)
- Starch and sucrose metabolism (14)
- Maturity onset diabetes of the young (13)
- Propanoate metabolism (13)
- C21-Steroid hormone metabolism (12)
- Sphingolipid metabolism (12)
- beta-Alanine metabolism (12)
- Linoleic acid metabolism (11)
- Lysine degradation (11)
- Oxidative phosphorylation (11)
- Primary bile acid biosynthesis (11)
- Phenylalanine metabolism (10)
- Porphyrin and chlorophyll metabolism (9)
- Proteasome (9)
- Ascorbate and aldarate metabolism (8)
- Folate biosynthesis (8)
- RNA degradation (8)
- Asthma (7)
- Basal transcription factors (7)
- Glycine (7)
- Limonene and pinene degradation (7)
- Pentose and glucuronate interconversions (7)
- Ribosome (7)
- serine and threonine metabolism (7)
- Fatty acid biosynthesis (6)
- Other glycan degradation (6)
- Riboflavin metabolism (6)
- Caffeine metabolism (5)
- Nicotinate and nicotinamide metabolism (5)
- Pantothenate and CoA biosynthesis (5)
- Selenoamino acid metabolism (5)
- Taurine and hypotaurine metabolism (5)
- Glycosaminoglycan degradation (4)
- Steroid biosynthesis (4)
- Terpenoid backbone biosynthesis (4)
- leucine and isoleucine biosynthesis (4)
- Aminoacyl-tRNA biosynthesis (3)
- Biosynthesis of unsaturated fatty acids (3)
- Circadian rhythm - mammal (3)
- Ether lipid metabolism (3)
- Glyoxylate and dicarboxylate metabolism (3)
- Spliceosome (3)
- Vitamin B6 metabolism (3)
- Glycosphingolipid biosynthesis - ganglio series (2)
- Heparan sulfate biosynthesis (2)
- Methane metabolism (2)
- One carbon pool by folate (2)
- Phenylalanine (2)
- Synthesis and degradation of ketone bodies (2)
- Ubiquinone and other terpenoid-quinone biosynthesis (2)
- alpha-Linolenic acid metabolism (2)
- tyrosine and tryptophan biosynthesis (2)
- Chondroitin sulfate biosynthesis (1)
- D-Glutamine and D-glutamate metabolism (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Lysine biosynthesis (1)
- N-Glycan biosynthesis (1)
- Sulfur metabolism (1)