NT5E Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NT5E |
NT5E Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human NT5E |
Rabbit Polyclonal Anti-ADCY6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADCY6 antibody: synthetic peptide directed towards the C terminal of human ADCY6. Synthetic peptide located within the following region: LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY |
Rabbit Polyclonal p53R2 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 . |
Rabbit polyclonal anti-PDE3B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 948 of mouse PDE3B. |
Rabbit polyclonal anti-ADCY5/6 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY5/6. |
Rabbit Polyclonal Anti-NT5C3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C3 Antibody: A synthesized peptide derived from human NT5C3 |
Rabbit Polyclonal antibody to ENTPD6 (ectonucleoside triphosphate diphosphohydrolase 6 (putative function))
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 114 and 285 of ENTPD6 |
Rabbit Polyclonal Adenylate Cyclase 3 Antibody
Applications | IF, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Raised against a 20 amino acid peptide corresponding to the C-terminus of rat Adenylate Cyclase 3 (PAAFPNGSSVTLPHQVVDNP). |
Rabbit polyclonal anti-ADCY5/ADCY6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthetic peptide derived from internal of human ADCY5/ADCY6. (UniProt O95622 and O43306). |
Rabbit polyclonal anti-ADCY8 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY8. |
Rabbit Polyclonal T-cadherin Antibody
Applications | IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | T-cadherin antibody was raised against a 15 amino acid peptide from near the amino terminus of human T-cadherin. |
Rabbit polyclonal antibody to ENTPD5(CD39L4) (ectonucleoside triphosphate diphosphohydrolase 5)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 191 of ENTPD5 (Uniprot ID#O75356) |
Rabbit polyclonal antibody to ENTPD3 (ectonucleoside triphosphate diphosphohydrolase 3)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 200 and 459 of ENTPD3 (Uniprot ID#O75355) |
Rabbit anti-ADCY6 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Rabbit polyclonal anti-ADCY1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY1. |
Rabbit polyclonal anti-RRM2B antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human RRM2B. |
ENTPD2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | ENTPD2 antibody was raised against synthetic 17 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Panda, Dog, Horse (94%); Marmoset, Mouse, Rat, Hamster, Elephant, Bovine (88%); Opossum, Xenopus (82%). |
Rabbit polyclonal RRM2B p53R2 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Anti-Human RRM2B/p53R2 antibody was prepared by repeated immunizations with a synthetic peptide corresponding to a region near the N-terminus of human RRM2B1 protein. A residue of cysteine was added to facilitate coupling. |
Rabbit anti-ADCY2 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Rabbit anti-ADCY9 polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Rabbit polyclonal anti-NT5E antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human NT5E. |
Rabbit polyclonal anti-ADCY4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADCY4. |
CD203c Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Dog, Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Gibbon, Monkey, Marmoset, Dog (100%); Bovine, Horse, Pig (95%); Panda, Bat (84%). |
CD203c Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from C-Terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan (100%); Chimpanzee (95%); Gibbon, Hamster (89%); Monkey (84%). |
CD203c Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Orang-Utan |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ENPP3. Percent identity with other species by BLAST analysis: Human, Orangutan, Monkey (100%); Gibbon (95%); Rat, Rabbit, Pig (80%). |
CD203c Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Human |
Conjugation | Unconjugated |
Immunogen | ENPP3 / CD203c antibody was raised against synthetic 19 amino acid peptide from internal region of human ENPP3. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Orangutan, Marmoset (95%); Horse, Rabbit (84%). |
ENTPD2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | ENTPD2 antibody was raised against synthetic 18 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (94%); Gibbon, Bovine (89%); Elephant, Panda (83%). |
ENTPD2 Rabbit Polyclonal (Internal) Antibody
Applications | IHC |
Reactivities | Gibbon, Chimpanzee, Human, Monkey |
Conjugation | Unconjugated |
Immunogen | ENTPD2 antibody was raised against synthetic 14 amino acid peptide from internal region of human ENTPD2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon, Monkey (100%); Gorilla, Bovine, Horse (93%); Galago, Elephant, Guinea pig (86%). |
Rabbit Polyclonal Anti-NT5C3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII |
Rabbit Polyclonal Anti-ENTPD6 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENTPD6 Antibody is: synthetic peptide directed towards the C-terminal region of Human ENTPD6. Synthetic peptide located within the following region: ALRMFNRTYKLYSYSYLGLGLMSARLAILGGVEGQPAKDGKELVSPCLSP |
Rabbit Polyclonal Anti-PDE3A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDE3A antibody: synthetic peptide directed towards the N terminal of human PDE3A. Synthetic peptide located within the following region: LLADPSLPPNVCTSLRAVSNLLSTQLTFQAIHKPRVNPVTSLSENYTCSD |
Rabbit Polyclonal Anti-PDE3B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PDE3B antibody: synthetic peptide directed towards the middle region of human PDE3B. Synthetic peptide located within the following region: SRPEYNFLLHLDHVEFKRFRFLVIEAILATDLKKHFDFLAEFNAKANDVN |
Rabbit Polyclonal Anti-ENTPD8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ENTPD8 Antibody: synthetic peptide directed towards the N terminal of human ENTPD8. Synthetic peptide located within the following region: IPEAQHRKTPTFLGATAGMRLLSRKNSSQARDIFAAVTQVLGRSPVDFWG |
Rabbit Polyclonal Anti-ADCY2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADCY2 antibody: synthetic peptide directed towards the middle region of human ADCY2. Synthetic peptide located within the following region: FLSDSEETIPPTANTTNTSFSASNNQVAILRAQNLFFLPYFIYSCILGLI |
Rabbit Polyclonal Anti-SAC Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SAC antibody: synthetic peptide directed towards the N terminal of human SAC. Synthetic peptide located within the following region: VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL |
Rabbit Polyclonal Anti-ENTPD1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ENTPD1 antibody: synthetic peptide directed towards the N terminal of human ENTPD1. Synthetic peptide located within the following region: AREVIPRSQHQETPVYLGATAGMRLLRMESEELADRVLDVVERSLSNYPF |
Anti-ADCY1 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1057-1070 amino acids of human adenylate cyclase 1 (brain) |
Anti-ADCY1 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1057-1070 amino acids of human adenylate cyclase 1 (brain) |
Anti-ENPP3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3 |
Anti-ENPP3 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 850-864 amino acids of Human ectonucleotide pyrophosphatase/phosphodiesterase 3 |
Anti-ADCY7 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 520-535 amino acids of human adenylate cyclase 7 |
Anti-ADCY4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 808-1077 amino acids of human adenylate cyclase 4 |
Anti-ADCY4 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 808-1077 amino acids of human adenylate cyclase 4 |
Anti-ADCY5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1110-1124 amino acids of human adenylate cyclase 5 |
Anti-ADCY5 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 1110-1124 amino acids of human adenylate cyclase 5 |
Rabbit Polyclonal Anti-NT5E Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human NT5E |
Rabbit Polyclonal Anti-ADCY3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ADCY3 |
Rabbit Polyclonal Anti-ENTPD5 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human ENTPD5 |
Rabbit Polyclonal Anti-ENTPD1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human ENTPD1 |
ADCY8 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human ADCY8 |