Germany
Japan
United Kingdom
China
Red Blood Cells rabbit polyclonal antibody, Purified
| Applications | AGG, IHC |
| Reactivities | Human |
| Immunogen | Human washed pooled Red Blood Cells (RBC) |
Antibodies
Normal Rabbit IgG rabbit polyclonal antibody, Purified
Biotinylated Anti-Human IL-17E Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IL-17E |
Rabbit Polyclonal tdTomato Antibody
| Applications | WB |
| Immunogen | tdTomato |
Rabbit Polyclonal mCherry Antibody
| Applications | WB |
| Immunogen | mCherry |
Rabbit Polyclonal turboGFP Antibody
| Applications | WB |
| Immunogen | Purified tGFP protein expressed in E. coli. |
Rabbit Anti-Mouse IgG Secondary Antibody
| Applications | WB, IHC, IF/ICC, ELISA |
| Reactivities | Mouse IgG |
| Conjugation | Unconjugated |
| Immunogen | Mouse IgG, whole molecule |
Collagen II (COL2A1) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, IP, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Sheep |
| Immunogen | Collagen type II purified from Human knee and Bovine nasal cartilage. |
Rabbit Polyclonal mKate Antibody
| Applications | WB |
| Immunogen | Purified mKate protein expressed in E. coli. |
Anti-DDK (FLAG) rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Synthetic peptide (DYKDDDDK) conjugated to KLH |
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Rabbit Polyclonal mGFP Antibody
| Applications | WB |
| Immunogen | mGFP |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit polyclonal DDR1 (Tyr513) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human DDR1 around the phosphorylation site of tyrosine 513 (P-A-YP-R-L). |
| Modifications | Phospho-specific |
PGK1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bakers Yeast |
| Immunogen | 3-Phosphoglyceric Phosphokinase isolated and purified from baker's yeast. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Anti-Dendra2 rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Purified Dendra2 protein expressed in E. coli. |
Peroxidase Conjugated Rabbit Anti-Goat IgG (gamma-chain specific)
| Applications | WB: 1:3,000-10,000; ELISA: 1:20,000-40,000 |
| Reactivities | Goat IgG |
| Conjugation | HRP |
| Immunogen | Goat IgG, whole molecule |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
DiMethyl-Histone H3-K4 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K4 of human histone H3 |
EDG1 (S1PR1) rabbit polyclonal antibody, Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide derived from the C-terminal of the EDG-1 receptor |
Anti-MYC tag rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Synthetic peptide (EQKLISEEDL) conjugated to KLH |
Anti-His tag rabbit polyclonal antibody
| Applications | WB |
| Immunogen | Synthetic peptide (HHHHHH) conjugated to KLH |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
DiMethyl-Histone H3-K36 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding K36 of human histone H3 |
GFP (Ads. to Hu, Ms, Rt Serum Proteins) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, WB |
| Reactivities | A. victoria |
| Immunogen | Green Fluorescent Protein (GFP) fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria |
Symmetric DiMethyl-Histone H3-R8 Rabbit Polyclonal Antibody
| Applications | ChIP, ICC/IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat, Other (Wide Range) |
| Conjugation | Unconjugated |
| Immunogen | A synthetic methylated peptide corresponding to residues surrounding R8 of human histone H3 |
Rabbit Polyclonal Anti-ACTB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ACTB antibody is: synthetic peptide directed towards the middle region of Human ACTB. Synthetic peptide located within the following region: TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRK |
Active filters
Category
Antibody Hosts
- Rabbit
Isotypes
- IgG
Clonalities
- Polyclonal
Filter by
Target Symbol
- EGFR (74)
- AKT1 (65)
- H3C1 (63)
- TP53 (60)
- RELA (51)
- MAPT (47)
- JUN (40)
- IRS1 (36)
- CTNNB1 (31)
- STAT3 (31)
- STAT1 (30)
- BCL2 (29)
- ESR1 (29)
- MAP2K1 (29)
- NFKBIA (29)
- SMAD3 (29)
- CREB1 (28)
- ERBB2 (28)
- GSK3B (28)
- MAPK14 (28)
- APP (27)
- PRKCD (27)
- RB1 (27)
- SMAD2 (27)
- BRCA1 (26)
- CASP3 (26)
- CHUK (26)
- FOXO1 (26)
- NR3C1 (26)
- RAF1 (26)
- ATF2 (25)
- HIST1H3A (25)
- JAK2 (25)
- KDR (25)
- NFKB1 (25)
- S PROTEIN (25)
- YAP1 (25)
- CHEK1 (24)
- H3-4 (24)
- HISTONE H3 (24)
- IGF1R (24)
- PRKAA1 (24)
- SMAD1 (24)
- BRAF (23)
- CDC25A (23)
- EZR (23)
- MAPK1 (23)
- NOS3 (23)
- PRKCA (23)
- PTEN (23)
- PTK2 (23)
- RPS6KB1 (23)
- BAX (22)
- EIF4EBP1 (22)
- HIF1A (22)
- MAPK8 (22)
- VIM (22)
- ALB (21)
- BAD (21)
- CD44 (21)
- CHEK2 (21)
- HDAC2 (21)
- HSPB1 (21)
- MAP3K5 (21)
- MAP3K7 (21)
- MET (21)
- SNCA (21)
- TNF (21)
- UBB (21)
- CASP9 (20)
- CCNB1 (20)
- CDK1 (20)
- GRIN1 (20)
- GSK3A (20)
- MYC (20)
- STAT5A (20)
- STAT6 (20)
- SYN1 (20)
- CDH1 (19)
- CSF1R (19)
- FOS (19)
- GRIN2B (19)
- IKBKG (19)
- PDGFRB (19)
- PPARG (19)
- RPS6KA1 (19)
- SRC (19)
- TGFB1 (19)
- TH (19)
- TSC2 (19)
- VEGFA (19)
- CDKN2A (18)
- IKBKB (18)
- IL1B (18)
- IL4 (18)
- NOS2 (18)
- PAK1 (18)
- TNFSF11 (18)
- AR (17)
- BCL2L1 (17)
Reactivities
- Human (51235)
- Mouse (30426)
- Rat (21913)
- Bovine (760)
- Monkey (371)
- Pig (291)
- Chicken (252)
- Dog (219)
- Rabbit (181)
- Rhesus Monkey (168)
- Xenopus (161)
- Gorilla (157)
- Chimpanzee (132)
- Gibbon (122)
- Zebrafish (120)
- Hamster (118)
- X. tropicalis (101)
- Horse (99)
- Murine (78)
- Bat (70)
- Primate (42)
- Cow (38)
- Orang-Utan (38)
- Other (Wide Range) (34)
- SARS-CoV-2 (31)
- Guinea Pig (27)
- Broad (26)
- Sheep (25)
- Porcine (20)
- Feline (19)
- Macaque (19)
- Drosophila (18)
- Canis (12)
- Canine (9)
- Fish (6)
- Goat (6)
- Equine (5)
- Mammalian (5)
- SARS-CoV (5)
- Opossum (4)
- Arabidopsis (3)
- EV-71 (3)
- Escherichia coli (3)
- Fusion proteins containing the Flag Tag (3)
- HCoV-HKU1 (3)
- HCoV-OC43 (3)
- Turkey (3)
- Yeast (3)
- C. elegans (2)
- HCoV-229E (2)
- Invertebrate (2)
- Pufferfish (2)
- Saccharomyces cerevisiae (2)
- 5-FAM (1)
- Algal (1)
- Baboon (1)
- Biotin (1)
- Digoxin (1)
- FITC (1)
- Ferret (1)
- Frog (1)
- HCoV-NL63 (1)
- Horseradish Peroxidase (1)
- Insect (1)
- Medaka fish (1)
- Quail (1)
- SimianIVE (1)
- Staphylococcus aureus (1)
- Streptococcus Pyogenes (1)
- Tadpole (1)
- Tobacco hornworm (1)
Applications
Conjugates
Knockout (KO) Validation
Modifications
- Unmodified (9273)
- Phospho-specific (1460)
- Phospho S83 (6)
- Acetyl K5 (4)
- Phospho S15 (3)
- Phospho S166 (3)
- Phospho S376 (3)
- Phospho T286 (3)
- Acetyl K12 (2)
- Acetyl K16 (2)
- Acetyl K27 (2)
- Acetyl K36 (2)
- Acetyl K4 (2)
- MonoMethyl K342 (2)
- Phospho S104 (2)
- Phospho S127 (2)
- Phospho S128 (2)
- Phospho S129 (2)
- Phospho S139 (2)
- Phospho S16 (2)
- Phospho S176/180 (2)
- Phospho S21 (2)
- Phospho S319 (2)
- Phospho S345 (2)
- Phospho S366 (2)
- Phospho S37 (2)
- Phospho S380 (2)
- Phospho S39 (2)
- Phospho S396 (2)
- Phospho S56 (2)
- Phospho S616 (2)
- Phospho S727 (2)
- Phospho S795 (2)
- Phospho S89 (2)
- Phospho S9 (2)
- Phospho T183/T172 (2)
- Phospho T187 (2)
- Phospho T389 (2)
- Phospho T514 (2)
- Phospho Y410 (2)
- Phospho Y779 (2)
- Phospho Y925 (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K262/K265/K274 (1)
- Acetyl K29 (1)
- Acetyl K332 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- DiMethyl K385 (1)
- K11-linkage Specific Polyubiquitin (1)
- K27-linkage Specific Polyubiquitin (1)
- K29-linkage Specific Polyubiquitin (1)
- K33-linkage Specific Polyubiquitin (1)
- K48-linkage Specific Polyubiquitin (1)
- K6-linkage Specific Polyubiquitin (1)
- K63-linkage Specific Polyubiquitin (1)
- M1-linkage Specific Polyubiquitin (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- Pan Acetyl-Lysine (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho 180/Y182,Phospho T180/Y182,Phospho T180/Y182,Phospho T183/Y1845 (1)
- Phospho Phospho S87 (1)
- Phospho S1 (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S102 (1)
- Phospho S1033 (1)
- Phospho S11 (1)
- Phospho S1105 (1)
- Phospho S1108 (1)
- Phospho S112 (1)
- Phospho S1177 (1)
- Phospho S1248 (1)
- Phospho S1387 (1)
- Phospho S1490 (1)
- Phospho S157 (1)
- Phospho S16/T17 (1)
- Phospho S17 (1)
- Phospho S172 (1)
- Phospho S176 (1)
- Phospho S180 (1)
- Phospho S182 (1)
- Phospho S189,Phospho S207 (1)
- Phospho S19 (1)
- Phospho S194 (1)
- Phospho S1943 (1)
- Phospho S1981 (1)
- Phospho S199/S204 (1)
- Phospho S2 (1)
- Phospho S20 (1)
- Phospho S202 (1)
- Phospho S2056 (1)
- Phospho S209 (1)
- Phospho S211 (1)
- Phospho S2152 (1)
- Phospho S217 (1)
- Phospho S22 (1)
- Phospho S235/236 (1)
- Phospho S240/244 (1)
- Phospho S241 (1)
- Phospho S243 (1)
- Phospho S2448 (1)
- Phospho S2481 (1)
- Phospho S253 (1)
- Phospho S257 (1)
- Phospho S257/T261 (1)
- Phospho S259 (1)
- Phospho S271 (1)
- Phospho S271/T275 (1)
- Phospho S28 (1)
- Phospho S280 (1)
- Phospho S29/33/37/T41 (1)
- Phospho S291 (1)
- Phospho S293 (1)
- Phospho S294 (1)
- Phospho S296 (1)
- Phospho S298 (1)
- Phospho S299 (1)
- Phospho S304 (1)
- Phospho S307 (1)
- Phospho S308,Phospho S309,Phospho S305 (1)
- Phospho S32 (1)
- Phospho S32/S36 (1)
- Phospho S320 (1)
- Phospho S323 (1)
- Phospho S326 (1)
- Phospho S33 (1)
- Phospho S33/35 (1)
- Phospho S33/S37/T41 (1)
- Phospho S330 (1)
- Phospho S334 (1)
- Phospho S338 (1)
- Phospho S358 (1)
- Phospho S36 (1)
- Phospho S365 (1)
- Phospho S380/T382/383 (1)
- Phospho S386 (1)
- Phospho S392 (1)
- Phospho S397 (1)
- Phospho S4/S8 (1)
- Phospho S40 (1)
- Phospho S409/S410 (1)
- Phospho S412 (1)
- Phospho S420 (1)
- Phospho S422 (1)
- Phospho S423/S425 (1)
- Phospho S425 (1)
- Phospho S428 (1)
- Phospho S445 (1)
- Phospho S448 (1)
- Phospho S45 (1)
- Phospho S455 (1)
- Phospho S46 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S465/S467 (1)
- Phospho S467 (1)
- Phospho S471/472 (1)
- Phospho S473 (1)
- Phospho S473,Phospho S474,Phospho S472 (1)
- Phospho S474 (1)
- Phospho S483 (1)
- Phospho S485 (1)
- Phospho S5 (1)
- Phospho S505 (1)
- Phospho S507 (1)
- Phospho S51 (1)
- Phospho S516 (1)
- Phospho S519/T522 (1)
- Phospho S529 (1)
- Phospho S552 (1)
- Phospho S555 (1)
- Phospho S563 (1)
- Phospho S588 (1)
- Phospho S6 (1)
- Phospho S608 (1)
- Phospho S611/615 (1)
- Phospho S611/615/616 (1)
- Phospho S612 (1)
- Phospho S615 (1)
- Phospho S62 (1)
- Phospho S621 (1)
- Phospho S63 (1)
- Phospho S636/639 (1)
- Phospho S637 (1)
- Phospho S638 (1)
- Phospho S641 (1)
- Phospho S643/676 (1)
- Phospho S645 (1)
- Phospho S65 (1)
- Phospho S657/Y658 (1)
- Phospho S660 (1)
- Phospho S668 (1)
- Phospho S675 (1)
- Phospho S7 (1)
- Phospho S70 (1)
- Phospho S71 (1)
- Phospho S728 (1)
- Phospho S73 (1)
- Phospho S744/748 (1)
- Phospho S757 (1)
- Phospho S80 (1)
- Phospho S807/811 (1)
- Phospho S811 (1)
- Phospho S82 (1)
- Phospho S838/S840 (1)
- Phospho S845 (1)
- Phospho S886 (1)
- Phospho S890 (1)
- Phospho S896/S897 (1)
- Phospho S897 (1)
- Phospho S916 (1)
- Phospho S932 (1)
- Phospho S957 (1)
- Phospho S967 (1)
- Phospho Ser15 (1)
- Phospho Ser198/Ser199/Ser202 (1)
- Phospho Ser355 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho Ser551 (1)
- Phospho Ser729 (1)
- Phospho Ser792 (1)
- Phospho Ser90 (1)
- Phospho T11 (1)
- Phospho T117 (1)
- Phospho T14 (1)
- Phospho T1462 (1)
- Phospho T156 (1)
- Phospho T163 (1)
- Phospho T17 (1)
- Phospho T172 (1)
- Phospho T179 (1)
- Phospho T18 (1)
- Phospho T18/S19 (1)
- Phospho T180/T183 (1)
- Phospho T180/Y182 (1)
- Phospho T180/Y182 + T183/Y1845 (1)
- Phospho T181 (1)
- Phospho T183/Y185 (1)
- Phospho T183/Y185,Phospho T221/Y223 (1)
- Phospho T184/T187 (1)
- Phospho T186 (1)
- Phospho T189 (1)
- Phospho T197 (1)
- Phospho T197/202 (1)
- Phospho T1989 (1)
- Phospho T199 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T202/Y204+T185/Y187 (1)
- Phospho T204 (1)
- Phospho T210 (1)
- Phospho T212 (1)
- Phospho T217 (1)
- Phospho T23 (1)
- Phospho T231 (1)
- Phospho T231/S232 (1)
- Phospho T232 (1)
- Phospho T235 (1)
- Phospho T24,Phospho T32,Phospho T28 (1)
- Phospho T246 (1)
- Phospho T261 (1)
- Phospho T288 (1)
- Phospho T288,Phospho T232,Phospho T198 (1)
- Phospho T292 (1)
- Phospho T3 (1)
- Phospho T308 (1)
- Phospho T32 (1)
- Phospho T320 (1)
- Phospho T334 (1)
- Phospho T346 (1)
- Phospho T357/S358/S360 (1)
- Phospho T359 (1)
- Phospho T359/S363 (1)
- Phospho T37/46 (1)
- Phospho T384 (1)
- Phospho T387 (1)
- Phospho T395 (1)
- Phospho T410 (1)
- Phospho T421/S424 (1)
- Phospho T434 (1)
- Phospho T446 (1)
- Phospho T45 (1)
- Phospho T495 (1)
- Phospho T498 (1)
- Phospho T505 (1)
- Phospho T508/T505 (1)
- Phospho T538 (1)
- Phospho T543 (1)
- Phospho T56 (1)
- Phospho T567,Phospho T564,Phospho T558 (1)
- Phospho T573 (1)
- Phospho T58 (1)
- Phospho T581 (1)
- Phospho T6 (1)
- Phospho T641 (1)
- Phospho T642 (1)
- Phospho T668 (1)
- Phospho T669 (1)
- Phospho T678 (1)
- Phospho T69/71 (1)
- Phospho T69/T71 (1)
- Phospho T696 (1)
- Phospho T70 (1)
- Phospho T81 (1)
- Phospho T845 (1)
- Phospho T853 (1)
- Phospho T91 (1)
- Phospho T918 (1)
- Phospho T93 (1)
- Phospho T982 (1)
- Phospho Thr212/Ser214 (1)
- Phospho Thr421 (1)
- Phospho Y10 (1)
- Phospho Y1007 (1)
- Phospho Y1007/1008 (1)
- Phospho Y1008 (1)
- Phospho Y1018 (1)
- Phospho Y1020 (1)
- Phospho Y1021 (1)
- Phospho Y1022/1023 (1)
- Phospho Y1045 (1)
- Phospho Y1054/1055 (1)
- Phospho Y1068 (1)
- Phospho Y1070 (1)
- Phospho Y1086 (1)
- Phospho Y1096 (1)
- Phospho Y1148 (1)
- Phospho Y1165/1166,Phospho Y1189/1190 (1)
- Phospho Y1173 (1)
- Phospho Y1175 (1)
- Phospho Y1189/Y1190,Phospho Y1165/Y1166 (1)
- Phospho Y1217 (1)
- Phospho Y1221/1222 (1)
- Phospho Y1234/1235 (1)
- Phospho Y1248 (1)
- Phospho Y1284 (1)
- Phospho Y133 (1)
- Phospho Y1349 (1)
- Phospho Y1361 (1)
- Phospho Y138 (1)
- Phospho Y139 (1)
- Phospho Y14 (1)
- Phospho Y145 (1)
- Phospho Y1474 (1)
- Phospho Y15 (1)
- Phospho Y165 (1)
- Phospho Y171 (1)
- Phospho Y177 (1)
- Phospho Y182 (1)
- Phospho Y191 (1)
- Phospho Y204 (1)
- Phospho Y207 (1)
- Phospho Y216 (1)
- Phospho Y221 (1)
- Phospho Y232 (1)
- Phospho Y245 (1)
- Phospho Y284 (1)
- Phospho Y291 (1)
- Phospho Y292 (1)
- Phospho Y307 (1)
- Phospho Y311 (1)
- Phospho Y317 (1)
- Phospho Y322 (1)
- Phospho Y323 (1)
- Phospho Y340 (1)
- Phospho Y353 (1)
- Phospho Y397 (1)
- Phospho Y402 (1)
- Phospho Y412 (1)
- Phospho Y416 (1)
- Phospho Y416/Y416 (1)
- Phospho Y467/Y199/Y464 (1)
- Phospho Y564 (1)
- Phospho Y576/577 (1)
- Phospho Y589/591 (1)
- Phospho Y594 (1)
- Phospho Y653 (1)
- Phospho Y659 (1)
- Phospho Y674/675 + Y706/707 (1)
- Phospho Y694 (1)
- Phospho Y699 (1)
- Phospho Y700 (1)
- Phospho Y705 (1)
- Phospho Y708 (1)
- Phospho Y719 (1)
- Phospho Y723 (1)
- Phospho Y724 (1)
- Phospho Y731 (1)
- Phospho Y751 (1)
- Phospho Y754 (1)
- Phospho Y759 (1)
- Phospho Y771 (1)
- Phospho Y789 (1)
- Phospho Y792 (1)
- Phospho Y845 (1)
- Phospho Y849 (1)
- Phospho Y869 (1)
- Phospho Y980/981 (1)
- Phospho Y992 (1)
- Phospho Y996 (1)
- Phospho Y998 (1)
- Phospho pS221 (1)
- Phospho s724 (1)
- Phospho-(Ser/Thr) (1)
- Phospho-PKC (pan) (βII Ser660) (1)
- Phospho-RPS6KB1-S371 (1)
- Ubiquityl K119 (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
- monoMethyl E105 (1)
- pan Phospho-Serine/Threonine (1)
- pan Symmetric-DiMethyl-Arginine (1)
- pan-Di-Methyl K (1)
- pan-Mono-Methyl K (1)
- pan-Mono-MethylR（R*GG） (1)
- pan-Myristyl-G (1)
- pan-Phospho-Serine (1)
- pan-TriMethyl-lysine (1)
- pan-tri-Methyl K (1)
- phospho S76 (1)
- phospho T1079,Phospho T1041 (1)
- succinylation K79 (1)
Assay Types
Families
- Druggable Genome (17895)
- Transmembrane (8180)
- Transcription Factors (5584)
- Secreted Protein (2708)
- Protein Kinase (2105)
- ES Cell Differentiation/IPS (1700)
- Stem cell - Pluripotency (1170)
- Protease (1033)
- GPCR (879)
- Adult stem cells (381)
- Phosphatase (323)
- Embryonic stem cells (320)
- Nuclear Hormone Receptor (320)
- Cancer stem cells (264)
- Ion Channels: Other (256)
- Stem cell relevant signaling - JAK/STAT signaling pathway (231)
- Induced pluripotent stem cells (197)
- P450 (153)
- Ion Channels: Potassium (145)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (121)
- Stem cell relevant signaling - DSL/Notch pathway (115)
- Ion Channels: Cys-loop Receptors (103)
- Stem cell relevant signaling - Wnt Signaling pathway (92)
- Ion Channels: Glutamate Receptors (72)
- Ion Channels: Transient receptor potential (64)
- Ion Channels: Sodium (34)
- Ion Channels: ATP Receptors (21)
- Ion Channels: Cyclic nucleotide gated (14)
- Ion Channels: Calcium (11)
Pathways
- Pathways in cancer (2184)
- Metabolic pathways (2181)
- MAPK signaling pathway (1395)
- Focal adhesion (1106)
- Cytokine-cytokine receptor interaction (1037)
- Chemokine signaling pathway (932)
- Neurotrophin signaling pathway (896)
- Prostate cancer (875)
- Neuroactive ligand-receptor interaction (833)
- Regulation of actin cytoskeleton (827)
- Cell cycle (740)
- Colorectal cancer (728)
- Pancreatic cancer (725)
- Chronic myeloid leukemia (720)
- Jak-STAT signaling pathway (698)
- Insulin signaling pathway (687)
- T cell receptor signaling pathway (687)
- ErbB signaling pathway (683)
- Wnt signaling pathway (681)
- Apoptosis (655)
- Small cell lung cancer (643)
- Toll-like receptor signaling pathway (643)
- Endocytosis (627)
- Calcium signaling pathway (616)
- Leukocyte transendothelial migration (586)
- Alzheimer's disease (582)
- Melanoma (552)
- Acute myeloid leukemia (543)
- Huntington's disease (539)
- Progesterone-mediated oocyte maturation (532)
- Glioma (528)
- Natural killer cell mediated cytotoxicity (517)
- B cell receptor signaling pathway (516)
- Adipocytokine signaling pathway (513)
- Endometrial cancer (496)
- Non-small cell lung cancer (493)
- Adherens junction (486)
- Tight junction (482)
- Fc gamma R-mediated phagocytosis (477)
- Axon guidance (461)
- Melanogenesis (460)
- GnRH signaling pathway (459)
- p53 signaling pathway (457)
- Oocyte meiosis (456)
- VEGF signaling pathway (449)
- Renal cell carcinoma (447)
- Epithelial cell signaling in Helicobacter pylori infection (442)
- Fc epsilon RI signaling pathway (421)
- Olfactory transduction (417)
- Gap junction (409)
- TGF-beta signaling pathway (407)
- Bladder cancer (397)
- NOD-like receptor signaling pathway (397)
- Ubiquitin mediated proteolysis (396)
- Vascular smooth muscle contraction (387)
- Amyotrophic lateral sclerosis (ALS) (386)
- RIG-I-like receptor signaling pathway (375)
- Cell adhesion molecules (CAMs) (355)
- mTOR signaling pathway (345)
- Parkinson's disease (319)
- Systemic lupus erythematosus (319)
- Long-term potentiation (316)
- Hematopoietic cell lineage (311)
- Long-term depression (304)
- Pathogenic Escherichia coli infection (294)
- Purine metabolism (293)
- Dilated cardiomyopathy (282)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (271)
- Cytosolic DNA-sensing pathway (271)
- Hypertrophic cardiomyopathy (HCM) (270)
- Basal cell carcinoma (256)
- Type II diabetes mellitus (247)
- PPAR signaling pathway (243)
- Viral myocarditis (240)
- ECM-receptor interaction (239)
- Spliceosome (232)
- Thyroid cancer (231)
- Complement and coagulation cascades (216)
- Lysosome (211)
- Glycolysis / Gluconeogenesis (204)
- Antigen processing and presentation (198)
- Notch signaling pathway (186)
- Hedgehog signaling pathway (184)
- Oxidative phosphorylation (181)
- Prion diseases (180)
- Drug metabolism - cytochrome P450 (177)
- Metabolism of xenobiotics by cytochrome P450 (177)
- Pyrimidine metabolism (174)
- Phosphatidylinositol signaling system (167)
- Vibrio cholerae infection (162)
- Arginine and proline metabolism (158)
- Dorso-ventral axis formation (156)
- Nucleotide excision repair (148)
- Cardiac muscle contraction (142)
- Primary immunodeficiency (142)
- Ribosome (138)
- Arachidonic acid metabolism (134)
- Retinol metabolism (134)
- Valine (133)
- Type I diabetes mellitus (123)
- Tyrosine metabolism (123)
- Proteasome (122)
- Pyruvate metabolism (121)
- RNA degradation (121)
- Fatty acid metabolism (118)
- Tryptophan metabolism (116)
- leucine and isoleucine degradation (116)
- Base excision repair (113)
- Autoimmune thyroid disease (112)
- Inositol phosphate metabolism (112)
- Allograft rejection (109)
- DNA replication (109)
- Glycerophospholipid metabolism (108)
- ABC transporters (107)
- Glycerolipid metabolism (107)
- Regulation of autophagy (107)
- Drug metabolism - other enzymes (106)
- Homologous recombination (105)
- Alanine (104)
- aspartate and glutamate metabolism (104)
- Graft-versus-host disease (102)
- Maturity onset diabetes of the young (100)
- Butanoate metabolism (98)
- Glutathione metabolism (97)
- Basal transcription factors (95)
- Fructose and mannose metabolism (94)
- Lysine degradation (94)
- Cysteine and methionine metabolism (92)
- Starch and sucrose metabolism (89)
- Sphingolipid metabolism (88)
- Taste transduction (88)
- Citrate cycle (TCA cycle) (86)
- Amino sugar and nucleotide sugar metabolism (80)
- Asthma (79)
- Mismatch repair (79)
- Androgen and estrogen metabolism (78)
- Porphyrin and chlorophyll metabolism (77)
- Propanoate metabolism (72)
- Histidine metabolism (71)
- Glycine (69)
- serine and threonine metabolism (69)
- Nitrogen metabolism (66)
- Linoleic acid metabolism (64)
- Non-homologous end-joining (64)
- Galactose metabolism (62)
- Pentose phosphate pathway (61)
- Ether lipid metabolism (59)
- Renin-angiotensin system (59)
- SNARE interactions in vesicular transport (57)
- beta-Alanine metabolism (57)
- Aminoacyl-tRNA biosynthesis (55)
- Phenylalanine metabolism (53)
- N-Glycan biosynthesis (51)
- Nicotinate and nicotinamide metabolism (46)
- Selenoamino acid metabolism (45)
- Biosynthesis of unsaturated fatty acids (43)
- Primary bile acid biosynthesis (43)
- RNA polymerase (43)
- Pentose and glucuronate interconversions (42)
- Ascorbate and aldarate metabolism (40)
- Riboflavin metabolism (39)
- Terpenoid backbone biosynthesis (38)
- Glycosaminoglycan degradation (36)
- Circadian rhythm - mammal (34)
- Glyoxylate and dicarboxylate metabolism (33)
- Limonene and pinene degradation (33)
- O-Glycan biosynthesis (33)
- C21-Steroid hormone metabolism (32)
- Folate biosynthesis (30)
- One carbon pool by folate (29)
- Chondroitin sulfate biosynthesis (28)
- Glycosphingolipid biosynthesis - lacto and neolacto series (28)
- Taurine and hypotaurine metabolism (28)
- Heparan sulfate biosynthesis (27)
- alpha-Linolenic acid metabolism (27)
- Pantothenate and CoA biosynthesis (25)
- Synthesis and degradation of ketone bodies (25)
- Other glycan degradation (24)
- Caffeine metabolism (23)
- Keratan sulfate biosynthesis (23)
- leucine and isoleucine biosynthesis (21)
- Glycosphingolipid biosynthesis - ganglio series (20)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (20)
- Steroid biosynthesis (20)
- Sulfur metabolism (18)
- Methane metabolism (17)
- Glycosphingolipid biosynthesis - globo series (16)
- Fatty acid elongation in mitochondria (15)
- Fatty acid biosynthesis (14)
- Lysine biosynthesis (13)
- Phenylalanine (13)
- tyrosine and tryptophan biosynthesis (13)
- Cyanoamino acid metabolism (12)
- Protein export (12)
- Vitamin B6 metabolism (12)
- D-Glutamine and D-glutamate metabolism (10)
- Thiamine metabolism (9)
- Lipoic acid metabolism (6)
- O-Mannosyl glycan biosynthesis (5)
- Ubiquinone and other terpenoid-quinone biosynthesis (5)
- D-Arginine and D-ornithine metabolism (1)