Germany
Japan
United Kingdom
China
ABCC4 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human ABCC4 |
Antibodies
View as table Download
ENaC Gamma Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | SCNN1G / ENaC Gamma antibody was raised against synthetic peptide from human SCNN1G. |
Rabbit polyclonal SCNN1A Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCNN1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 365-391 amino acids from the Central region of human SCNN1A. |
Rabbit polyclonal Anti-KCNAB2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNAB2 antibody: synthetic peptide directed towards the middle region of human KCNAB2. Synthetic peptide located within the following region: WGGKAETERGLSRKHIIEGLKASLERLQLEYVDVVFANRPDPNTPMEETV |
Rabbit polyclonal anti-NOX1 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX1. |
Rabbit polyclonal antibody to chloride channel 5 (chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease))
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 62 and 393 of CLC-5 (Uniprot ID#P51795) |
Rabbit anti-CLCN1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLCN1 |
Rabbit Polyclonal Anti-VDAC2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-VDAC2 antibody: A synthesized peptide derived from human VDAC2 |
Rabbit polyclonal antibody to SCNN1A (sodium channel, nonvoltage-gated 1 alpha)
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 182 and 459 of SCNN1A (Uniprot ID#P37088) |
Rabbit polyclonal anti-CLCN7 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human CLCN7. |
Rabbit polyclonal anti-NOX5 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human NOX5. |
Rabbit polyclonal CLC4 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CLC4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 663-689 amino acids from the C-terminal region of human CLC4. |
Rabbit anti-GJA4 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GJA4 |
Rabbit anti-CLCN5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CLCN5 |
Rabbit anti-BEST1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human BEST1 |
Rabbit Polyclonal Anti-Connexin 26 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 26 Antibody: A synthesized peptide derived from the extracellular region of human Connexin 26 |
Rabbit Polyclonal Anti-Connexin 32 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 32 Antibody: A synthesized peptide derived from human Connexin 32 |
Rabbit Polyclonal Anti-AQP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AQP1 Antibody: A synthesized peptide derived from human AQP1 |
Rabbit Polyclonal Anti-Connexin 43 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Connexin 43 Antibody: A synthesized peptide derived from human Connexin 43 |
Rabbit Polyclonal Anti-GJB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GJB2 antibody was raised against a 16 amino acid peptide near the center of human GJB2. |
Rabbit Polyclonal Anti-Trophinin Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Trophinin antibody was raised against a 16 amino acid peptide near the amino terminus of human Trophinin. |
Rabbit Polyclonal Anti-TNFAIP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TNFAIP1 antibody was raised against a 19 amino acid peptide from near the carboxy terminus of human TNFAIP1. |
Rabbit polyclonal Connexin 43 (Ser265) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Connexin 43 around the phosphorylation site of Serine 265. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-AQP1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AQP1. |
Rabbit polyclonal anti-CLIC3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLIC3. |
Rabbit polyclonal anti-CLCN4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLCN4. |
Rabbit polyclonal anti-CLNS1A antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human CLNS1A. |
Rabbit polyclonal anti-GJA3 antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GJA3. |
Rabbit polyclonal anti-SCN7A antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SCN7A. |
Rabbit polyclonal anti-TNAP1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TNAP1. |
Rabbit polyclonal anti-KCNMB2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KCNMB2. |
Rabbit polyclonal anti-CLCC1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CLCC1. |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Active filters
Category
- Antibodies
Reactivities
- Human
Antibody Hosts
- Rabbit
Conjugates
- Unconjugated
Families
- Ion Channels: Other
Filter by
Target Symbol
- CACNB2 (14)
- GJA1 (10)
- KCNIP2 (7)
- CACNB1 (6)
- CLIC1 (6)
- KCNH6 (6)
- AQP1 (5)
- CLIC4 (5)
- CYBB (5)
- SCNN1A (5)
- TNFAIP1 (5)
- VDAC2 (5)
- CHRFAM7A (4)
- GJB2 (4)
- KCNAB2 (4)
- KCNIP4 (4)
- KCNMB2 (4)
- NOX1 (4)
- VDAC1 (4)
- BEST4 (3)
- CACNA2D4 (3)
- CACNB3 (3)
- CACNG6 (3)
- CLCC1 (3)
- CLIC3 (3)
- FXYD5 (3)
- GJA4 (3)
- GJB1 (3)
- GJC1 (3)
- GJC2 (3)
- GJD2 (3)
- NOX5 (3)
- NUDT9 (3)
- VDAC3 (3)
- ABCC4 (2)
- ASIC1 (2)
- ASIC2 (2)
- ASIC4 (2)
- BEST1 (2)
- CACNB4 (2)
- CACNG1 (2)
- CACNG4 (2)
- CATSPER3 (2)
- CLCA4 (2)
- CLCN3 (2)
- CLCN4 (2)
- CLCN5 (2)
- CLIC2 (2)
- CLIC5 (2)
- CLNS1A (2)
- FXYD1 (2)
- FXYD7 (2)
- GJA3 (2)
- GJA8 (2)
- GJB4 (2)
- KCNH7 (2)
- KCNMB3 (2)
- KCNMB4 (2)
- KCTD1 (2)
- KCTD10 (2)
- KCTD11 (2)
- KCTD15 (2)
- KCTD6 (2)
- POLR2M (2)
- SCNN1B (2)
- SHKBP1 (2)
- TOMM40L (2)
- TTYH1 (2)
- ZACN (2)
- ASIC3 (1)
- ASIC5 (1)
- CACNA2D1 (1)
- CACNA2D2 (1)
- CACNA2D3 (1)
- CACNG7 (1)
- CATSPER1 (1)
- CATSPER2 (1)
- CATSPER4 (1)
- CLCA1 (1)
- CLCA2 (1)
- CLCN1 (1)
- CLCN6 (1)
- CLCN7 (1)
- GJB5 (1)
- KCNAB3 (1)
- KCNE1 (1)
- KCNE3 (1)
- KCNG3 (1)
- KCNIP1 (1)
- KCNMB1 (1)
- KCTD13 (1)
- KCTD17 (1)
- KCTD18 (1)
- KCTD7 (1)
- MLC1 (1)
- SCN7A (1)
- SCNN1D (1)
- SCNN1G (1)
- TOMM40 (1)
- TPCN1 (1)
Clonalities
Modifications
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (49)
- Cardiac muscle contraction (39)
- Dilated cardiomyopathy (39)
- Hypertrophic cardiomyopathy (HCM) (39)
- MAPK signaling pathway (39)
- Gap junction (13)
- Calcium signaling pathway (12)
- Huntington's disease (12)
- Parkinson's disease (12)
- Taste transduction (10)
- Leukocyte transendothelial migration (9)
- Vascular smooth muscle contraction (9)
- Olfactory transduction (4)
- Amyotrophic lateral sclerosis (ALS) (3)
- Purine metabolism (3)
- ABC transporters (2)