Rabbit Polyclonal Anti-LCAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LCAT antibody: synthetic peptide directed towards the C terminal of human LCAT. Synthetic peptide located within the following region: GVLYEDGDDTVATRSTELCGLWQGRQPQPVHLLPLHGIQHLNMVFSNLTL |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the middle region of human PPAP2A. Synthetic peptide located within the following region: DPDWSKINCSDGYIEYYICRGNAERVKEGRLSFYSGHSSFSMYCMLFVAL |
Rabbit Polyclonal Anti-AGPAT6 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human AGPAT6 |
Rabbit polyclonal LCAT Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This LCAT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 285-313 amino acids from the Central region of human LCAT. |
Anti-PLA2G2A Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 21-144 amino acids of human phospholipase A2, group IIA (platelets, synovial fluid) |
Rabbit Polyclonal Anti-LCAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LCAT antibody: synthetic peptide directed towards the N terminal of human LCAT. Synthetic peptide located within the following region: MGPPGSPWQWVTLLLGLLLPPAAPFWLLNVLFPPHTTPKAELSNHTRPVI |
Rabbit Polyclonal Anti-PPAP2A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QRGVFCNDESIKYPYKEDTIPYALLGGIIIPFSIIVIILGETLSVYCNLL |
Rabbit polyclonal anti-DGKE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DGKE. |
Anti-PPAP2C Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-269 amino acids of human phosphatidic acid phosphatase type 2C |
Rabbit Polyclonal Anti-LYCAT Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LYCAT antibody: synthetic peptide directed towards the middle region of human LYCAT. Synthetic peptide located within the following region: YLYSLVKWYFIITIVIFVLQERIFGGLEIIELACYRLLHKQPHLNSKKNE |
Rabbit Polyclonal anti-PPAP2A antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPAP2A antibody: synthetic peptide directed towards the N terminal of human PPAP2A. Synthetic peptide located within the following region: QIYPFQRGFFCKDNSINYPYHDSTVTSTVLILVGVGLPISSIILGETLSV |
Rabbit polyclonal Anti-CRLS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CRLS1 antibody: synthetic peptide directed towards the middle region of human CRLS1. Synthetic peptide located within the following region: WTIPNMLSMTRIGLAPVLGYLIIEEDFNIALGVFALAGLTDLLDGFIARN |
Rabbit Polyclonal Anti-PEMT Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PEMT Antibody: synthetic peptide directed towards the C terminal of human PEMT. Synthetic peptide located within the following region: GWAIMHASPTGLLLTVLVALTYIVALLYEEPFTAEIYRQKASGSHKRS |
Rabbit Polyclonal Anti-GPD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPD2 antibody: synthetic peptide directed towards the N terminal of human GPD2. Synthetic peptide located within the following region: DILVIGGGATGSGCALDAVTRGLKTALVERDDFSSGTSSRSTKLIHGGVR |
Rabbit Polyclonal Anti-DGKE Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DGKE antibody: synthetic peptide directed towards the N terminal of human DGKE. Synthetic peptide located within the following region: EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR |
Rabbit Polyclonal Anti-CDS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CDS2 antibody is: synthetic peptide directed towards the C-terminal region of Human CDS2. Synthetic peptide located within the following region: EYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIA |
Rabbit Polyclonal Anti-PTDSS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTDSS2 antibody: synthetic peptide directed towards the N terminal of human PTDSS2. Synthetic peptide located within the following region: GQATGPGEGRRSTESEVYDDGTNTFFWRAHTLTVLFILTCTLGYVTLLEE |
Rabbit Polyclonal Anti-PTDSS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTDSS1 antibody: synthetic peptide directed towards the N terminal of human PTDSS1. Synthetic peptide located within the following region: MASCVGSRTLSKDDVNYKMHFRMINEQQVEDITIDFFYRPHTITLLSFTI |
Rabbit Polyclonal Anti-GDE1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GDE1 antibody: synthetic peptide directed towards the N terminal of human GDE1. Synthetic peptide located within the following region: LRVFSFEPVPSCRALQVLKPRDRISAIAHRGGSHDAPENTLAAIRQAAKN |
Rabbit Polyclonal Anti-AGPAT3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGPAT3 antibody: synthetic peptide directed towards the middle region of human AGPAT3. Synthetic peptide located within the following region: KRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAA |
Rabbit Polyclonal Anti-AGPAT4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGPAT4 antibody: synthetic peptide directed towards the middle region of human AGPAT4. Synthetic peptide located within the following region: EMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRFTEKKHEISM |
Rabbit polyclonal anti-AGPAT3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AGPAT3. |
Rabbit polyclonal anti-AGPAT4 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AGPAT4. |
Rabbit Polyclonal Anti-GPD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPD2 antibody is: synthetic peptide directed towards the N-terminal region of Human GPD2. Synthetic peptide located within the following region: LSCDVEVRRGDVLAAWSGIRPLVTDPKSADTQSISRNHVVDISESGLITI |
Rabbit Polyclonal Anti-GPD2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPD2 antibody: synthetic peptide directed towards the middle region of human GPD2. Synthetic peptide located within the following region: GQVELNEFLQLMSAIQKGRVSGSRLAILMKTAEENLDRRVPIPVDRSCGG |
Rabbit Polyclonal Anti-AGPAT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-AGPAT2 Antibody: synthetic peptide directed towards the C terminal of human AGPAT2. Synthetic peptide located within the following region: LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA |
Rabbit Polyclonal Anti-PTDSS2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PTDSS2 antibody: synthetic peptide directed towards the middle region of human PTDSS2. Synthetic peptide located within the following region: QAWLVAAITATELLIVVKYDPHTLTLSLPFYISQCWTLGSVLALTWTVWR |
Rabbit Polyclonal Anti-PLA2G2E Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLA2G2E antibody: synthetic peptide directed towards the middle region of human PLA2G2E. Synthetic peptide located within the following region: GIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPP |
Rabbit Polyclonal Anti-AGPAT6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGPAT6 antibody: synthetic peptide directed towards the middle region of human AGPAT6. Synthetic peptide located within the following region: MSKHVHLMCYRICVRALTAIITYHDRENRPRNGGICVANHTSPIDVIILA |
Anti-AGPAT4 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 146-306 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 4 |
Anti-PPAP2A Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 40-53 amino acids of human phosphatidic acid phosphatase type 2A |
Anti-AGPAT2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 244-278 amino acids of human 1-acylglycerol-3-phosphate O-acyltransferase 2 |
Rabbit Polyclonal Anti-AGPAT6 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human AGPAT6 |
Germany
Japan
United Kingdom
China
