Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal CD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to an C-terminal region of the human CD4 protein (within residues 400-458). [Swiss-Prot P01730] |
Rabbit polyclonal Neuro D (Ser274) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Neuro D around the phosphorylation site of serine 274 (P-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit Polyclonal CD44 (Ser706) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human CD44 around the phosphorylation site of Serine 706 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-SOX9 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOX9 antibody: synthetic peptide directed towards the C terminal of human SOX9. Synthetic peptide located within the following region: AGQGTGLYSTFTYMNPAQRPMYTPIADTSGVPSIPQTHSPQHWEQPVYTQ |
Rabbit Polyclonal GATA3 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GATA3 antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human GATA3. The immunogen is located within amino acids 340 - 390 of GATA3. |
Rabbit polyclonal APOE antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human APOE. |
Rabbit anti-IGFBP1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IGFBP1 |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-Wnt-6 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 276 of mouse Wnt-6 |
Anti-ERBB3 (phospho-Tyr1328) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 1328 (P-D-Y(p)-W-H) derived from Human Her3/ErbB3. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-HDAC1 antibody, Loading control
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | This HDAC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 70-99 amino acids from the N-terminal region of human HDAC1. |
FGF10 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FGF10 |
Rabbit Polyclonal Anti-BMP6 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-BMP6 antibody: synthetic peptide directed towards the middle region of human BMP6. Synthetic peptide located within the following region: MVAFFKVSEVHVRTTRSASSRRRQQSRNRSTQSQDVARVSSASDYNSSEL |
Rabbit Polyclonal Anti-Neuro D Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Neuro D Antibody: A synthesized peptide derived from human Neuro D |
Rabbit Polyclonal Anti-OCT3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-OCT3 Antibody: A synthesized peptide derived from human 41185 |
Rabbit Polyclonal Anti-EGFR Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGFR Antibody: A synthesized peptide derived from human EGFR |
Rabbit Polyclonal Anti-MAP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP2 Antibody: Peptide sequence around aa.1819~1823 (T-A-A-L-A) derived from Human MAP2. |
Rabbit Polyclonal Anti-Cdx2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Cdx2 Antibody: Peptide sequence around aa.12~16(S-M-Y-P-S) derived from Human Cdx2 |
Rabbit Polyclonal Anti-CD9 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD9 Antibody: A synthesized peptide |
Rabbit Polyclonal Anti-EGF Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-EGF Antibody: A synthesized peptide derived from human EGF |
Rabbit Polyclonal Anti-CD34 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CD34 Antibody: A synthesized peptide derived from human CD34 |
Rabbit Polyclonal Anti-MAP 2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MAP 2 Antibody: A synthesized peptide derived from human MAP 2 |
Rabbit Polyclonal Anti-Notch 1 (Cleaved-Val1744) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Notch 1 (Cleaved-Val1744) Antibody: A synthesized peptide derived from human Notch 1 (Cleaved-Val1744) |
Rabbit Polyclonal Anti-HDAC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | HDAC1 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human HDAC1. |
Rabbit polyclonal EGFR (Tyr1172) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
| Modifications | Phospho-specific |
Rabbit polyclonal TAL-1 (Ser122) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human TAL-1 around the phosphorylation site of serine 122 (Q-L-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-EGFR antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR. |
Active filters
Reactivities
- Rat
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Families
- Adult stem cells
Filter by
Category
Target Symbol
- EGFR (28)
- HDAC1 (12)
- GATA1 (7)
- MAP2 (6)
- SOX2 (6)
- BDNF (5)
- CDX2 (5)
- FGF4 (5)
- HNF1A (5)
- KIT (5)
- NOTCH1 (5)
- POU5F1 (5)
- SOX9 (5)
- NEUROD1 (4)
- BMP2 (3)
- BMP6 (3)
- CD44 (3)
- EGF (3)
- ERBB3 (3)
- HGF (3)
- KLF4 (3)
- SOX1 (3)
- APOE (2)
- BMP4 (2)
- CD34 (2)
- CD9 (2)
- DKK2 (2)
- FGF7 (2)
- IGFBP1 (2)
- LEF1 (2)
- LIF (2)
- PDGFC (2)
- SFRP1 (2)
- WNT5A (2)
- WNT6 (2)
- BMP5 (1)
- BMP7 (1)
- CCN4 (1)
- CD4 (1)
- DKK4 (1)
- DLL1 (1)
- FGF10 (1)
- GATA3 (1)
- GDF3 (1)
- GDF9 (1)
- GLI3 (1)
- HES1 (1)
- IGFBP2 (1)
- PAX3 (1)
- PAX6 (1)
- PAX7 (1)
- SMURF2 (1)
- SOX10 (1)
- TAL1 (1)
- WNT1 (1)
- WNT2 (1)
Isotypes
Conjugates
Modifications
Pathways
- Pathways in cancer (73)
- Cytokine-cytokine receptor interaction (47)
- MAPK signaling pathway (44)
- Melanoma (44)
- Endocytosis (43)
- Regulation of actin cytoskeleton (41)
- Focal adhesion (36)
- Prostate cancer (35)
- ErbB signaling pathway (34)
- Dorso-ventral axis formation (33)
- Endometrial cancer (33)
- Gap junction (33)
- Bladder cancer (31)
- Calcium signaling pathway (31)
- Glioma (31)
- Non-small cell lung cancer (31)
- Pancreatic cancer (31)
- Adherens junction (30)
- Colorectal cancer (30)
- Epithelial cell signaling in Helicobacter pylori infection (28)
- GnRH signaling pathway (28)
- Notch signaling pathway (19)
- Hedgehog signaling pathway (17)
- Huntington's disease (17)
- Hematopoietic cell lineage (16)
- Melanogenesis (16)
- Basal cell carcinoma (14)
- Wnt signaling pathway (13)
- Cell cycle (12)
- Chronic myeloid leukemia (12)
- Maturity onset diabetes of the young (11)
- TGF-beta signaling pathway (11)
- Acute myeloid leukemia (10)
- Neurotrophin signaling pathway (5)
- Prion diseases (5)
- Cell adhesion molecules (CAMs) (4)
- ECM-receptor interaction (3)
- Renal cell carcinoma (3)
- Alzheimer's disease (2)
- Antigen processing and presentation (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Jak-STAT signaling pathway (2)
- Thyroid cancer (2)
- Allograft rejection (1)
- Autoimmune thyroid disease (1)
- Graft-versus-host disease (1)
- Primary immunodeficiency (1)
- T cell receptor signaling pathway (1)
- Type I diabetes mellitus (1)
- Ubiquitin mediated proteolysis (1)
- Viral myocarditis (1)