Rabbit Polyclonal antibody to MMP2 (matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 193 and 575 of MMP2 (Uniprot ID#P08253) |
Rabbit anti-MMP2 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MMP2 |
Rabbit anti-MMP9 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MMP9 |
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP2 Antibody: A synthesized peptide derived from human MMP2 |
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MMP2 |
Rabbit Polyclonal MMP9 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody was made against a protein fragment from the C Terminus Region |
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP2 antibody: synthetic peptide directed towards the C terminal of human MMP2. Synthetic peptide located within the following region: AWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKFGSIKSDWL |
MMP9 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 548-578 amino acids from the C-terminal region of Human MMP-9 |
Rabbit polyclonal anti-MMP-9 antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | E. coli-expressed active rat 92-kDa type IV collagenase |
Rabbit Polyclonal MMP-9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MMP9. |
Rabbit Polyclonal Anti-MMP9 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | MMP9 / Gelatinase B antibody was raised against synthetic 12 amino acid peptide from internal region of human MMP9. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Bovine (100%); Monkey, Dog, Hamster, Rabbit (92%); Mouse, Panda, Horse, Pig, Chicken (83%). |
Rabbit Polyclonal Anti-MMP9 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | MMP9 / Gelatinase B antibody was raised against synthetic 13 amino acid peptide from internal region of human MMP9. Percent identity with other species by BLAST analysis: Human (100%); Gorilla (92%); Monkey, Marmoset, Pig (85%). |
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MMP2 |
Rabbit Polyclonal Anti-MMP2 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human MMP2 |
Germany
Japan
United Kingdom
China
