Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Cyclin D1 (CCND1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to amino acids 55-100 of Human Cyclin D1. |
Rabbit polyclonal Caspase 9 (Tyr153) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of tyrosine 153 (L-A-YP-I-L). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Caspase 9 (Thr125) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 around the phosphorylation site of Threonine 125 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Caspase 9 (Cleaved-Asp353) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Caspase 9 (Cleaved-Asp353) Antibody: A synthesized peptide derived from human Caspase 9 (Cleaved-Asp353) |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal CASP9 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9. |
Rabbit anti-CXADR Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CXADR |
Rabbit polyclonal anti-CXADR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CXADR. |
Rabbit Polyclonal Caspase 9 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Caspase 9 |
Rabbit Polyclonal Cyclin D1 Antibody
| Applications | WB |
| Reactivities | Human Mouse Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Thr286. |
Rabbit Polyclonal Cyclin D1 (Ser90) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin D1 around the phosphorylation site of Serine 90 |
| Modifications | Phospho-specific |
Caspase 9 (CASP9) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal antibody to Caspase-9 (caspase 9, apoptosis-related cysteine peptidase)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 88 and 416 of Caspase 9 (Uniprot ID#P55211) |
Rabbit polyclonal Phospho-Caspase 9(S196) Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Phospho-Caspase 9-S196 antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S196 of human caspase 9. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Cyclin D1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human Cyclin D1 |
Caspase 9 (CASP9) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Mouse, Rat |
| Immunogen | Synthetic peptide surrounding amino acid 345 of Mouse Caspase-9 |
Cyclin D1 (CCND1) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CCND1 |
Cyclin D1 (CCND1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of human Cyclin D1 |
Caspase 9 (CASP9) (301-305) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.301~305 derived from Caspase 9 |
Caspase 9 (CASP9) (301-305) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Peptide sequence around aa.301~305 derived from Caspase 9 |
Rabbit Polyclonal Caspase-9 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Caspase-9 antibody was raised against a peptide corresponding to amino acids 41 to 56 of human caspase-9 . |
Rabbit polyclonal Cyclin D1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Anti-Cyclin D1 was produced by repeated immunizations of full length fusion protein corresponding to the human gene sequence. |
Rabbit polyclonal CCND1 Antibody (C-term T288)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CCND1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 267-294 amino acids from the C-terminal region of human CCND1. |
Rabbit Polyclonal Anti-CXADR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CXADR Antibody: synthetic peptide directed towards the N terminal of human CXADR. Synthetic peptide located within the following region: ILYSGDKIYDDYYPDLKGRVHFTSNDLKSGDASINVTNLQLSDIGTYQCK |
Rabbit Polyclonal Anti-CXADR Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXADR antibody was raised against synthetic 15 amino acid peptide from internal region of human CXADR. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Zebra finch, Platypus, Lizard (93%); Xenopus, Stickleback, Pufferfish, Zebrafish (80%). |
Rabbit Polyclonal Anti-CXADR Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Immunogen | CXADR antibody was raised against synthetic 15 amino acid peptide from internal region of human CXADR. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon (100%); Monkey, Galago, Horse (93%); Marmoset, Mouse, Elephant, Panda, Bat, Bovine, Rabbit, Pig, Guinea pig (87%); Rat, Hamster (80%). |
Rabbit anti Cyclin D1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human cyclin D1 protein. This sequence is identical to human, mouse, rat. |
Anti-CASP9 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9 |
Anti-CASP9 (active) Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 41-56 amino acids of human caspase 9, apoptosis-related cysteine peptidase |
Anti-CCND1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1 |
Active filters
Category
-
Antibodies
- Primary Antibodies
Antibody Hosts
- Rabbit
Families
- Stem cell - Pluripotency
Pathways
- Viral myocarditis