Rabbit Polyclonal Antibody against GLUT1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
Rabbit Polyclonal Antibody against GLUT1
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166] |
Rabbit polyclonal anti-GLUT1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human GLUT1. |
Rabbit Polyclonal Anti-HGF Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human HGF |
MET pTyr1234 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal TGFβ3 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3. |
Rabbit polyclonal c-Met (Ab-1003) antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A). |
Modifications | Phospho-specific |
Rabbit polyclonal c-Met (Tyr1003) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human: Tyr1003, Mouse: Tyr1001, Rat: Tyr1004 |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-TGF beta2 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β2. |
Rabbit polyclonal anti-TGF beta3 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF β3. |
Rabbit Polyclonal Anti-TGF alpha Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TGF alpha Antibody: A synthesized peptide derived from human TGF alpha |
Rabbit Polyclonal Anti-MET Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human MET |
MET rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around amino acids 1001~1005 (V-D-Y-R-A) derived from Human Met. |
TGF beta 3 (TGFB3) (C-term) rabbit polyclonal antibody, Purified
Applications | IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide derived from the C-terminus of the precursor form of human TGF beta 3 |
Glucose Transporter GLUT1 (SLC2A1) rabbit polyclonal antibody
Applications | IF, IHC, WB |
Reactivities | Bovine, Human, Mouse, Primate, Rabbit, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Met (Ab-1234) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Met around the phosphorylation site of tyrosine 1234 (K-E-YP-Y-S). |
Modifications | Phospho-specific |
Rabbit polyclonal Met (Ab-1313) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human MET. |
Modifications | Phospho-specific |
Rabbit Polyclonal c-Met Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Met |
Rabbit Polyclonal Met Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Met |
Rabbit Polyclonal Met Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Met |
Rabbit Polyclonal c-Met (Tyr1003) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human c-Met around the phosphorylation site of Tyrosine 1003 |
Modifications | Phospho-specific |
Rabbit Polyclonal Met (Tyr1234) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Met around the phosphorylation site of Tyrosine 1234 |
Modifications | Phospho-specific |
Rabbit Polyclonal Met (Tyr1349) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human Met around the phosphorylation site of Tyrosine 1349 |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-HGF Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP |
MET rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Peptide sequence around amino acids 1001~1005 (V-D-Y-R-A) derived from Human Met. |
MET rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MET rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Rabbit polyclonal anti-TGF alpha antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human TGF alpha. |
Rabbit polyclonal anti-TGF-beta2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide surrounding amino acid 366 of human TGF-β2 |
Rabbit polyclonal c-Met phospho Y1349 / Y1356 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding Y1349 and Y1356 of human c-Met protein. |
MET rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
MET pTyr1349 rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
MET (C-term) rabbit polyclonal antibody, Purified
Applications | IHC |
Reactivities | Human |
Immunogen | MET antibody was raised against a synthetic peptide from C-terminus of human c-Met protein |
Rabbit polyclonal anti-MET (met proto-oncogene) antibody
Applications | IF |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MET |
Modifications | Phospho-specific |
Rabbit polyclonal Met (Tyr1349) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Met around the phosphorylation site of tyrosine 1349 (E-H-YP-V-H). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-TGF-alpha antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed human TGF-a |
Rabbit polyclonal anti-TGF-beta2 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | E. coli expressed recombinant human TGF-β2 |
Rabbit Polyclonal GLUT1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human GLUT1. |
Rabbit anti-HGF Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HGF |
Anti-Human TGF-a Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TGF-α |
Rabbit Polyclonal Anti-HGF Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG |
Rabbit Polyclonal Anti-HGF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HGF antibody: synthetic peptide directed towards the middle region of human HGF. Synthetic peptide located within the following region: NENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVI |
Rabbit anti GLUT-1 Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from C-terminus of human Glut-1 Protein. This sequence is identical to human and rat. |
Rabbit anti TGF-alpha Polyclonal Antibody
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti TGF-beta 2 Polyclonal Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A 21 aa of a synthetic peptide derived from C-terminus of human TGF-beta 2 protein. |
Rabbit anti c-Met Polyclonal Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide from C-terminus of human c-Met protein |
Anti-SLC2A1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide peptide corresponding to a region derived from 1-13 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 1 |
Anti-TGFA Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 24-98 amino acids of human transforming growth factor, alpha |
Rabbit Polyclonal GLUT1 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TGFB2 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TGFB2 |
TGFB2 Antibody - middle region
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human TGFB2 |