Antibodies

View as table Download

Rabbit Polyclonal Antibody against GLUT1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an N-terminal region of the human GLUT1 protein (between residues 1-100). [Swiss-Prot #P11166]

Rabbit polyclonal anti-GLUT1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human GLUT1.

Rabbit Polyclonal Anti-HGF Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HGF

MET pTyr1234 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal TGFβ3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human TGFB3.

Rabbit polyclonal c-Met (Ab-1003) antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A).
Modifications Phospho-specific

Rabbit polyclonal c-Met (Tyr1003) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Tyr1003, Mouse: Tyr1001, Rat: Tyr1004
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human c-Met around the phosphorylation site of tyrosine 1003 (V-D-YP-R-A).
Modifications Phospho-specific

Rabbit polyclonal anti-TGF beta2 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β2.

Rabbit polyclonal anti-TGF beta3 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β3.

Rabbit Polyclonal Anti-TGF alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-TGF alpha Antibody: A synthesized peptide derived from human TGF alpha

Rabbit Polyclonal Anti-MET Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human MET

MET rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around amino acids 1001~1005 (V-D-Y-R-A) derived from Human Met.

TGF beta 3 (TGFB3) (C-term) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide derived from the C-terminus of the precursor form of human TGF beta 3

Glucose Transporter GLUT1 (SLC2A1) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Human, Mouse, Primate, Rabbit, Rat
Conjugation Unconjugated

Rabbit polyclonal Met (Ab-1234) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Met around the phosphorylation site of tyrosine 1234 (K-E-YP-Y-S).
Modifications Phospho-specific

Rabbit polyclonal Met (Ab-1313) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human MET.
Modifications Phospho-specific

Rabbit Polyclonal c-Met Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Met

Rabbit Polyclonal Met Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Met

Rabbit Polyclonal Met Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Met

Rabbit Polyclonal c-Met (Tyr1003) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human c-Met around the phosphorylation site of Tyrosine 1003
Modifications Phospho-specific

Rabbit Polyclonal Met (Tyr1234) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Met around the phosphorylation site of Tyrosine 1234
Modifications Phospho-specific

Rabbit Polyclonal Met (Tyr1349) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human Met around the phosphorylation site of Tyrosine 1349
Modifications Phospho-specific

Rabbit Polyclonal Anti-HGF Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: VKKEFGHEFDLYENKDYIRNCIIGKGRSYKGTVSITKSGIKCQPWSSMIP

MET rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Peptide sequence around amino acids 1001~1005 (V-D-Y-R-A) derived from Human Met.

MET rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MET rabbit polyclonal antibody, Aff - Purified

Applications IF, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal anti-TGF alpha antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF alpha.

Rabbit polyclonal anti-TGF-beta2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 366 of human TGF-β2

Rabbit polyclonal c-Met phospho Y1349 / Y1356 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding Y1349 and Y1356 of human c-Met protein.

MET rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human

MET pTyr1349 rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MET (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human
Immunogen MET antibody was raised against a synthetic peptide from C-terminus of human c-Met protein

Rabbit polyclonal anti-MET (met proto-oncogene) antibody

Applications IF
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MET
Modifications Phospho-specific

Rabbit polyclonal Met (Tyr1349) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Met around the phosphorylation site of tyrosine 1349 (E-H-YP-V-H).
Modifications Phospho-specific

Rabbit polyclonal anti-TGF-alpha antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen E. coli-expressed human TGF-a

Rabbit polyclonal anti-TGF-beta2 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen E. coli expressed recombinant human TGF-β2

Rabbit Polyclonal GLUT1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human GLUT1.

Rabbit anti-HGF Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HGF

Anti-Human TGF-a Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TGF-α

Rabbit Polyclonal Anti-HGF Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-HGF antibody: synthetic peptide directed towards the N terminal of human HGF. Synthetic peptide located within the following region: GESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPDG

Rabbit Polyclonal Anti-HGF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HGF antibody: synthetic peptide directed towards the middle region of human HGF. Synthetic peptide located within the following region: NENYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNLDHPVI

Rabbit anti GLUT-1 Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from C-terminus of human Glut-1 Protein. This sequence is identical to human and rat.

Rabbit anti TGF-alpha Polyclonal Antibody

Reactivities Human
Conjugation Unconjugated

Rabbit anti TGF-beta 2 Polyclonal Antibody

Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A 21 aa of a synthetic peptide derived from C-terminus of human TGF-beta 2 protein.

Rabbit anti c-Met Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide from C-terminus of human c-Met protein

Anti-SLC2A1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 1-13 amino acids of human solute carrier family 2 (facilitated glucose transporter), member 1

Anti-TGFA Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 24-98 amino acids of human transforming growth factor, alpha

Rabbit Polyclonal GLUT1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-TGFB2 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human TGFB2

TGFB2 Antibody - middle region

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human TGFB2