Antibodies

View as table Download

Rabbit polyclonal antibody to Desmoglein-2 (desmoglein 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 206 of Desmoglein 2 (Uniprot ID#Q14126)

Rabbit Polyclonal antibody to Integrin alpha 6 (integrin, alpha 6)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 565 and 872 of Integrin alpha 6 (Uniprot ID#P23229)

Rabbit polyclonal Integrin Beta5 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Integrin β5.

Rabbit polyclonal Integrin beta1 (Thr789) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Integrin β1 around the phosphorylation site of threonine 789 (V-T-TP-V-V).
Modifications Phospho-specific

Rabbit polyclonal anti-Plakoglobin / Catenin-gamma antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Catenin-?.

Rabbit polyclonal Shc (Tyr427) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 427 (P-S-YP-V-N).
Modifications Phospho-specific

Rabbit polyclonal Shc (Ab-349) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Shc around the phosphorylation site of tyrosine 349 (H-Q-YP-Y-N).

Rabbit polyclonal Catenin-beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1.

Rabbit polyclonal anti-NOM1 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human NOM1.

Rabbit polyclonal anti-TCF7L1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TCF7L1.

Rabbit polyclonal CACNA2D2 Antibody (Center)

Applications IF, IHC, WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen This CACNA2D2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 643-671 amino acids from the Central region of human CACNA2D2.

Rabbit polyclonal CTNA1 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This CTNA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 30-59 amino acids from the N-terminal region of human CTNA1.

Rabbit polyclonal Lamin A (Cleaved-Asp230) antibody

Applications IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Lamin A.

Rabbit polyclonal Lamin A (Cleaved-Asp230) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Lamin A.

Rabbit Polyclonal Anti-Connexin-43

Applications IF, IHC, WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)HAQPFDFPDDNQNSK, corresponding to amino acids residues 331-345 of human Connexin-43. Intracellular, C-terminus.

Rabbit anti-ITGB5 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ITGB5

Rabbit anti-ITGA2B Polyclonal Antibody

Applications WB
Reactivities Mouse, Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ITGA2B

Rabbit Polyclonal Anti-CACNG1 Antibody - N-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cacng1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVHNKDKSCEHVTPSGEKNCSYFRHFNPGESSEIFEFTTQKEYSISAAAI

Rabbit Polyclonal Anti-PARVG Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PARVG antibody is: synthetic peptide directed towards the N-terminal region of Human PARVG. Synthetic peptide located within the following region: RKDPKFEELQKVLMEWINATLLPEHIVVRSLEEDMFDGLILHHLFQRLAA

Rabbit Polyclonal Anti-TCF7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TCF7 antibody is: synthetic peptide directed towards the N-terminal region of Human TCF7. Synthetic peptide located within the following region: AGGGDDLGAPDELLAFQDEGEEQDDKSRDSAAGPERDLAELKSSLVNESE

Rabbit Polyclonal Anti-ACTN3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACTN3 antibody: synthetic peptide directed towards the N terminal of human ACTN3. Synthetic peptide located within the following region: VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY

Rabbit Polyclonal Anti-Actin-pan Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Actin-pan Antibody: A synthesized peptide derived from human Actin-pan

Rabbit Polyclonal Anti-Desmin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Desmin Antibody: A synthesized peptide derived from human Desmin

Rabbit Polyclonal Anti-Integrin beta-5 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin beta-5 Antibody: A synthesized peptide derived from human Integrin beta-5

Rabbit Polyclonal Anti-N-Cadherin Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-N-Cadherin Antibody: Peptide sequence around aa.800~804(A-I-K-P-V) derived from Human N-Cadherin.

Rabbit Polyclonal Anti-Integrin aV Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin aV Antibody: A synthesized peptide derived from human Integrin aV

Rabbit Polyclonal Anti-Integrin a3 (CD49c) Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin a3 (CD49c) Antibody: A synthesized peptide

Rabbit Polyclonal Anti-Actinin a 2/3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Actinin a 2/3 Antibody: A synthesized peptide derived from human Actinin a 2/3

Rabbit Polyclonal Anti-Catenin a1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Catenin a1 Antibody: A synthesized peptide derived from human Catenin-a.

Rabbit Polyclonal Anti-Connexin 43 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Connexin 43 Antibody: A synthesized peptide derived from human Connexin 43

Rabbit Polyclonal Anti-Integrin β4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin β4 Antibody: A synthesized peptide derived from human Integrin β4

Rabbit Polyclonal Anti-Integrin β1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Integrin β1 Antibody: A synthesized peptide derived from human Integrin β1

Rabbit Polyclonal Anti-Beta actin antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Beta actin antibody: A synthesized peptide derived from human Beta actin

Rabbit Polyclonal Anti-CACNB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human CACNB1

Rabbit anti Dystrophin Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the intra domain 410-450aa of human Dystrophin protein. This sequence is identical to mouse and Pan troglodytes and other species.

Rabbit Polyclonal Integrin alpha 6 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Polyclonal CACNB2 Antibody

Applications ELISA, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the C Terminus Region of the target protein.

CDX2 rabbit monoclonal antibody, clone EPR2764Y, Supernatant

Applications IF, IHC, WB
Reactivities Human

CD61 (ITGB3) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Human, Mouse
Immunogen Synthetic peptide, corresponding to amino acids 741-790 of Human Integrin β3.

Desmin (DES) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 420-470 of Human Desmin.

CACNA2D1 (N-term) rabbit polyclonal antibody

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the N-terminal region of human CACNA2D1

Integrin alpha 1 (ITGA1) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 727-755 amino acids from the Central region of human ITGA1.

SHC (SHC1) rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat

beta Sarcoglycan (SGCB) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse

beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

beta Catenin (CTNNB1) pSer37 rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Lamin A (LMNA) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Lamin A (N-Terminus) rabbit polyclonal antibody, Affinity purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A peptide made from the last 8 amino acids of Lamin C, including an N-Terminus lysine as a linker (KHHVSGSRR), coupled to KLH

Integrin alpha 6 (ITGA6) (1043-1072) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from isoform 2 of human ITGA6.

Integrin alpha 4 (ITGA4) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide (GNSAGPKSMEVSC) from (C-term) of human NDRG1