Germany
Japan
United Kingdom
China
Antibodies
Tyrosine Hydroxylase (TH) mouse monoclonal antibody, clone LNC1
| Applications | IF, IHC, WB |
| Reactivities | All Species |
| Conjugation | Unconjugated |
VIP rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mammalian |
| Conjugation | Unconjugated |
| Immunogen | Porcine VIP coupled to bovine thyroglobulin (BTg) with carbodiimide (CDI) linker. |
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
Rabbit Polyclonal PD-L1 Antibody
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | PD-L1 antibody was raised against a 17 amino acid synthetic peptide from near the center of human PD-L1. The immunogen is located within amino acids 60 - 110 of PD-L1. |
Rabbit Polyclonal VLK Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | VLK antibody was raised against a 15 amino acid synthetic peptide from near the center of human VLK. The immunogen is located within amino acids 320 - 370 of VLK. |
Rabbit polyclonal SLC11A2 Antibody (Center)
| Applications | IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SLC11A2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 262-291 amino acids from the Central region of human SLC11A2. |
Rabbit Polyclonal OCLN Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | OCLN antibody was raised against a 15 amino acid synthetic peptide from near the carboxy terminus of human OCLN. The immunogen is located within the last 50 amino acids of OCLN. |
Calca rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Human, Mammalian, Mouse, Porcine, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic rat alpha-CGRP coupled to bovine thyroglobulin (BTg) with glutaraldehyde. |
Rabbit Polyclonal Anti-HNRPH1 Antibody - middle region
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPH1 antibody: synthetic peptide directed towards the middle region of human HNRPH1. Synthetic peptide located within the following region: FLNSTAGASGGAYEHRYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYG |
Rabbit Polyclonal H3K9/14ac Antibody
| Applications | Dot, ELISA, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-H3K9/14ac antibody: histone H3 acetylated at lysines 9 and 14 (H3K9/14ac), using a KLH-conjugated synthetic peptide. |
Rabbit Polyclonal Anti-TET1 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | TET1 antibody was raised against an 18 amino acid peptide near the carboxy terminus of human TET1. The immunogen is located within amino acids 2030 - 2080 of TET1. |
USD 479.00
2 Weeks
Active filters
Category
- Antibodies
Applications
- IF
Conjugates
- Unconjugated
Filter by
Target Symbol
- MAP2K1 (125)
- PDCD1 (89)
- CTAG1B (81)
- MAP2K3 (81)
- TP53 (73)
- LIPG (65)
- KLK8 (64)
- ERCC1 (61)
- ERBB2 (56)
- CDKN2A (55)
- L1CAM (54)
- VIM (53)
- MAPK13 (52)
- PNMT (48)
- EPCAM (47)
- SQSTM1 (47)
- MDM4 (45)
- PECAM1 (45)
- SYP (44)
- AKT1 (42)
- APP (42)
- CD163 (42)
- IDO1 (41)
- LOX (40)
- GFAP (39)
- CTNNB1 (38)
- MYC (38)
- MLANA (37)
- BSG (36)
- NPR3 (36)
- PTPRE (36)
- MCL1 (35)
- PSMC3 (35)
- ACAT2 (34)
- BUB1B (34)
- CD19 (34)
- IGF2BP2 (34)
- MIOX (34)
- PDE4A (34)
- SENP2 (34)
- TH (34)
- CCT8L2 (33)
- CDK2 (33)
- CHGA (33)
- MAPK7 (33)
- MOB3B (33)
- MTRF1L (33)
- NME4 (33)
- BTK (32)
- CD80 (32)
- MMP13 (32)
- TACC3 (32)
- UBE2G2 (32)
- BECN1 (31)
- ERG (31)
- H3C1 (31)
- KRT7 (31)
- ALDH1L1 (30)
- BTN1A1 (30)
- ERCC4 (30)
- FAHD2A (30)
- LENG1 (30)
- LIMK1 (30)
- MAPRE2 (30)
- PIK3AP1 (30)
- RNF144B (30)
- SMS (30)
- SNAP25 (30)
- SPG7 (30)
- VWA5A (30)
- AFP (29)
- PGAM2 (29)
- SOCS3 (29)
- EGFR (28)
- GBP2 (28)
- HIBCH (28)
- KRT19 (28)
- SNX9 (28)
- ARHGAP25 (27)
- CCM2 (27)
- CD1C (27)
- ELK3 (27)
- FOXI1 (27)
- HOXC11 (27)
- LGR5 (27)
- PARVA (27)
- PIK3R5 (27)
- POR (27)
- SAMHD1 (27)
- TAL1 (27)
- ATP5F1B (26)
- CD33 (26)
- PRKAR2A (26)
- PYCR2 (26)
- ACAA2 (25)
- CRYAB (25)
- CYP1A2 (25)
- DTYMK (25)
- GATA3 (25)
- HDAC6 (25)
Reactivities
- Human (18795)
- Mouse (13069)
- Rat (11720)
- Monkey (1750)
- Dog (1452)
- Bovine (404)
- Chicken (157)
- Pig (139)
- Rhesus Monkey (101)
- Xenopus (100)
- Zebrafish (82)
- Hamster (79)
- Canine (71)
- Primate (71)
- Rabbit (61)
- X. tropicalis (58)
- Porcine (54)
- Chimpanzee (45)
- Sheep (38)
- Cow (34)
- Feline (30)
- Mammalian (29)
- Drosophila (20)
- Guinea Pig (19)
- C. elegans (16)
- Goat (13)
- Avian (9)
- SARS-CoV (9)
- SARS-CoV-2 (7)
- Equine (6)
- Fish (6)
- Broad (5)
- Yeast (3)
- All Species (2)
- Beluga (2)
- Carp (2)
- Coral (2)
- Dengue virus (2)
- Fusion proteins containing the Flag Tag (2)
- West Nile Virus (2)
- Yellow Fever Virus (2)
- Birds (1)
- Chlamydomonas (1)
- Dogfish (1)
- Drosophila melanogaster (1)
- Frog (1)
- Fungus (1)
- Hagfish (1)
- Horse (1)
- Invertebrate (1)
- Medaka fish (1)
- Mink (1)
- Mustelid (1)
- Orang-Utan (1)
- Quail (1)
- SimianIVE (1)
- Staphylococcus aureus (1)
- Streptococcus Pyogenes (1)
- Tobacco (1)
- Tomato (1)
Antibody Hosts
Isotypes
Clonalities
Knockout (KO) Validation
Modifications
- Unmodified (2518)
- Phospho-specific (144)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. (32)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (14)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human Fab format, for improved compatibility with existing reagents, assays and techniques. (12)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (8)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (7)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG2b format, for improved compatibility with existing reagents, assays and techniques. (7)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG1 format, for improved compatibility with existing reagents, assays and techniques. (7)
- This reformatted human antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (6)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (5)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2a format, for improved compatibility with existing reagents, assays and techniques. (5)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgM format, for improved compatibility with existing reagents, assays and techniques. (4)
- Acetyl K5 (3)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (3)
- This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (3)
- Acetyl K12 (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. (2)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This is a chimeric antibody created for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (2)
- This chimeric rabbit antibody was made using the variable domain sequences of the original human scFv format, for improved compatibility with existing reagents, assays and techniques. (2)
- TriMethyl K56 (2)
- Acetyl K14 (1)
- Acetyl K15 (1)
- Acetyl K16 (1)
- Acetyl K18 (1)
- Acetyl K23 (1)
- Acetyl K27 (1)
- Acetyl K29 (1)
- Acetyl K36 (1)
- Acetyl K4 (1)
- Acetyl K56 (1)
- Acetyl K8 (1)
- Acetyl K9 (1)
- Acetyl K9/K14/K18/K23/K27 (1)
- Acetyl K91 (1)
- Asymmetric DiMethyl R3 (1)
- MonoMethyl K36 (1)
- MonoMethyl K5 (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- NOT FOR THERAPEUTIC USE - This is a research-grade biosimilar. This chimeric rabbit antibody was made using the variable domain sequences of the original human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Pan DiMethyl-lysine (1)
- Pan Phospho-Tyrosine (1)
- Phospho S10 (1)
- Phospho S10/T11 (1)
- Phospho S2056 (1)
- Phospho S241 (1)
- Phospho S2448 (1)
- Phospho S28 (1)
- Phospho S428 (1)
- Phospho S465/467 + S423/425 (1)
- Phospho S519/T522 (1)
- Phospho S70 (1)
- Phospho S9 (1)
- Phospho Ser404 (1)
- Phospho Ser416 (1)
- Phospho T11 (1)
- Phospho T180/Y182 (1)
- Phospho T202/Y204 + T185/Y187 (1)
- Phospho T389 (1)
- Phospho T395 (1)
- Phospho T45 (1)
- Phospho T498 (1)
- Phospho T6 (1)
- Phospho T91 (1)
- Phospho Y1022/1023 (1)
- Phospho Y15 (1)
- Phospho Y705 (1)
- This chimeric human antibody was made using the variable domain sequences of the original Mouse IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric mouse antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric murine antibody was made using the variable domain sequences of the original Human IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Armenian Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Hamster IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgM format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG3 format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original murine IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2a format, for improved compatibility with existing reagents, assays and techniques. (1)
- This chimeric rabbit antibody was made using the variable domain sequences of the original rat IgG2b format, for improved compatibility with existing reagents, assays and techniques. (1)
- This constant region of this antibody has been modified to bind to Protein A, allowing highly-specific purification of this antibody by Protein A-affinity column. (1)
- This full-length, chimeric rabbit antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This full-length, reformatted mouse antibody was made using the variable domain sequences of the original Mouse scFv format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted mouse antibody was made using the variable domain sequences of the original Mouse scFv antibody fragment format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG1 format, for improved compatibility with existing reagents, assays and techniques. (1)
- Unconjugated (1)
- citrulline R2/R8/R17 (1)
Assay Types
Families
- Druggable Genome (8747)
- Transmembrane (3116)
- Transcription Factors (1970)
- Protein Kinase (1227)
- ES Cell Differentiation/IPS (1145)
- Secreted Protein (1073)
- Stem cell - Pluripotency (579)
- Protease (499)
- GPCR (221)
- Adult stem cells (218)
- Phosphatase (152)
- Embryonic stem cells (150)
- P450 (119)
- Cancer stem cells (95)
- Stem cell relevant signaling - JAK/STAT signaling pathway (95)
- Induced pluripotent stem cells (91)
- Ion Channels: Other (87)
- Nuclear Hormone Receptor (79)
- Stem cell relevant signaling - DSL/Notch pathway (76)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (46)
- Ion Channels: Potassium (30)
- Stem cell relevant signaling - Wnt Signaling pathway (20)
- Ion Channels: Transient receptor potential (18)
- Ion Channels: Glutamate Receptors (9)
- Ion Channels: ATP Receptors (5)
- Ion Channels: Cyclic nucleotide gated (4)
- Ion Channels: Cys-loop Receptors (3)
- Ion Channels: Calcium (2)
- Ion Channels: Sodium (1)
Pathways
- Metabolic pathways (1624)
- Pathways in cancer (1163)
- MAPK signaling pathway (866)
- Focal adhesion (631)
- Neurotrophin signaling pathway (626)
- Prostate cancer (605)
- Toll-like receptor signaling pathway (577)
- Pancreatic cancer (560)
- Chronic myeloid leukemia (542)
- T cell receptor signaling pathway (542)
- Progesterone-mediated oocyte maturation (538)
- Colorectal cancer (531)
- Non-small cell lung cancer (521)
- Insulin signaling pathway (518)
- Fc epsilon RI signaling pathway (504)
- Melanoma (504)
- Endometrial cancer (502)
- ErbB signaling pathway (499)
- Regulation of actin cytoskeleton (492)
- Glioma (474)
- Bladder cancer (462)
- GnRH signaling pathway (423)
- B cell receptor signaling pathway (420)
- Chemokine signaling pathway (404)
- Cell cycle (400)
- Fc gamma R-mediated phagocytosis (399)
- Acute myeloid leukemia (395)
- Renal cell carcinoma (386)
- Cell adhesion molecules (CAMs) (385)
- Apoptosis (382)
- Gap junction (379)
- VEGF signaling pathway (368)
- Leukocyte transendothelial migration (331)
- Natural killer cell mediated cytotoxicity (331)
- Thyroid cancer (328)
- p53 signaling pathway (316)
- Oocyte meiosis (310)
- Small cell lung cancer (306)
- Amyotrophic lateral sclerosis (ALS) (303)
- Jak-STAT signaling pathway (287)
- Alzheimer's disease (284)
- Huntington's disease (279)
- Purine metabolism (279)
- Endocytosis (277)
- Wnt signaling pathway (275)
- Melanogenesis (251)
- Cytokine-cytokine receptor interaction (248)
- Hematopoietic cell lineage (244)
- Adherens junction (237)
- Vascular smooth muscle contraction (230)
- Axon guidance (224)
- Prion diseases (222)
- Parkinson's disease (215)
- Ubiquitin mediated proteolysis (215)
- Long-term potentiation (212)
- Adipocytokine signaling pathway (211)
- Pathogenic Escherichia coli infection (207)
- Long-term depression (205)
- Tight junction (204)
- Type II diabetes mellitus (200)
- mTOR signaling pathway (197)
- Neuroactive ligand-receptor interaction (191)
- Epithelial cell signaling in Helicobacter pylori infection (190)
- Glycolysis / Gluconeogenesis (183)
- NOD-like receptor signaling pathway (181)
- Calcium signaling pathway (180)
- RIG-I-like receptor signaling pathway (177)
- Pyrimidine metabolism (173)
- Systemic lupus erythematosus (171)
- Dorso-ventral axis formation (159)
- Basal cell carcinoma (157)
- Valine (157)
- Primary immunodeficiency (156)
- leucine and isoleucine degradation (146)
- TGF-beta signaling pathway (138)
- Nucleotide excision repair (133)
- Oxidative phosphorylation (126)
- Glycerolipid metabolism (123)
- Antigen processing and presentation (122)
- Arginine and proline metabolism (122)
- Tryptophan metabolism (119)
- Tyrosine metabolism (117)
- Olfactory transduction (107)
- Viral myocarditis (105)
- Pyruvate metabolism (102)
- Drug metabolism - cytochrome P450 (99)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (98)
- Metabolism of xenobiotics by cytochrome P450 (97)
- Cytosolic DNA-sensing pathway (96)
- Type I diabetes mellitus (94)
- Proteasome (92)
- Arachidonic acid metabolism (90)
- Fatty acid metabolism (89)
- Propanoate metabolism (89)
- PPAR signaling pathway (88)
- beta-Alanine metabolism (85)
- Regulation of autophagy (84)
- Graft-versus-host disease (82)
- Butanoate metabolism (81)
- Citrate cycle (TCA cycle) (79)
- Glutathione metabolism (78)
- Inositol phosphate metabolism (77)
- Phosphatidylinositol signaling system (77)
- Maturity onset diabetes of the young (72)
- Fructose and mannose metabolism (71)
- Hypertrophic cardiomyopathy (HCM) (71)
- Retinol metabolism (70)
- Base excision repair (69)
- Glycine (69)
- serine and threonine metabolism (69)
- Notch signaling pathway (67)
- Cysteine and methionine metabolism (66)
- Dilated cardiomyopathy (66)
- Vibrio cholerae infection (66)
- Lysosome (65)
- Lysine degradation (63)
- Spliceosome (61)
- Pentose phosphate pathway (57)
- Complement and coagulation cascades (56)
- Linoleic acid metabolism (56)
- RNA degradation (56)
- Amino sugar and nucleotide sugar metabolism (55)
- Terpenoid backbone biosynthesis (54)
- ECM-receptor interaction (53)
- Hedgehog signaling pathway (52)
- Cardiac muscle contraction (50)
- Allograft rejection (49)
- Mismatch repair (48)
- Autoimmune thyroid disease (47)
- DNA replication (44)
- Non-homologous end-joining (44)
- Synthesis and degradation of ketone bodies (44)
- One carbon pool by folate (42)
- Histidine metabolism (40)
- Homologous recombination (40)
- Ascorbate and aldarate metabolism (39)
- RNA polymerase (37)
- Drug metabolism - other enzymes (36)
- Galactose metabolism (36)
- Alanine (34)
- Caffeine metabolism (34)
- aspartate and glutamate metabolism (34)
- SNARE interactions in vesicular transport (33)
- Starch and sucrose metabolism (31)
- N-Glycan biosynthesis (29)
- Renin-angiotensin system (28)
- Folate biosynthesis (27)
- Nicotinate and nicotinamide metabolism (27)
- Sphingolipid metabolism (26)
- Fatty acid elongation in mitochondria (24)
- Porphyrin and chlorophyll metabolism (22)
- Primary bile acid biosynthesis (22)
- Glycosaminoglycan degradation (21)
- Biosynthesis of unsaturated fatty acids (20)
- Nitrogen metabolism (20)
- Other glycan degradation (20)
- Basal transcription factors (17)
- Glycerophospholipid metabolism (17)
- Glyoxylate and dicarboxylate metabolism (17)
- Ribosome (17)
- Sulfur metabolism (16)
- Circadian rhythm - mammal (15)
- Asthma (14)
- Pantothenate and CoA biosynthesis (14)
- Selenoamino acid metabolism (14)
- Androgen and estrogen metabolism (13)
- Fatty acid biosynthesis (12)
- Glycosphingolipid biosynthesis - lacto and neolacto series (11)
- Keratan sulfate biosynthesis (11)
- Methane metabolism (11)
- leucine and isoleucine biosynthesis (11)
- Glycosphingolipid biosynthesis - ganglio series (10)
- Taste transduction (10)
- Vitamin B6 metabolism (10)
- Taurine and hypotaurine metabolism (9)
- Aminoacyl-tRNA biosynthesis (8)
- Phenylalanine metabolism (8)
- ABC transporters (7)
- Limonene and pinene degradation (7)
- O-Glycan biosynthesis (7)
- Steroid biosynthesis (6)
- Heparan sulfate biosynthesis (5)
- C21-Steroid hormone metabolism (4)
- Pentose and glucuronate interconversions (4)
- Chondroitin sulfate biosynthesis (3)
- D-Glutamine and D-glutamate metabolism (3)
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis (2)
- Ether lipid metabolism (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Riboflavin metabolism (1)