Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 126 results

Page 1 of 3

(reset)

Glutathione Peroxidase 1 (GPX1) (C-term) Rabbit Polyclonal Antibody

AP51937PU-N

USD 450.00

2 Weeks

Glutathione Peroxidase 1 (GPX1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse
Immunogen	Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 164-193aa) of human Glutathione peroxidase 1 / GPX1.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

p53R2 (RRM2B) Rabbit Polyclonal Antibody

TA306062

USD 430.00

5 Days

Rabbit Polyclonal p53R2 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	p53R2 antibody was raised against a synthetic peptide corresponding to amino acids 2 to 17 of human p53R2 .

1 / 3

2 / 3

3 / 3

Previous Next

GST3 (GSTP1) Rabbit Polyclonal Antibody

TA306508

USD 430.00

5 Days

Rabbit Polyclonal GSTP1 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	GSTP1 antibody was raised against a 14 amino acid peptide from near the center of human GSTP1.

1 / 3

2 / 3

3 / 3

Previous Next

GCLM Mouse Monoclonal Antibody [Clone ID: AT2D12]

AM50016PU-S

USD 230.00

2 Weeks

GCLM mouse monoclonal antibody, clone AT2D12, Purified

Applications	ELISA, FC, IF, WB
Reactivities	Human

GSTA2 Rabbit Polyclonal Antibody

TA308025

USD 415.00

5 Days

Rabbit Polyclonal antibody to GSTA2 (glutathione S-transferase alpha 2)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 196 of GSTA2 (Uniprot ID#P09210)

1 / 3

2 / 3

3 / 3

Previous Next

RRM2 Mouse Monoclonal Antibody [Clone ID: 1E1]

AM20936PU-N

USD 480.00

2 Weeks

RRM2 mouse monoclonal antibody, clone 1E1, Purified

Applications	ELISA, IF, IHC, WB
Reactivities	Human

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GCLM Mouse Monoclonal Antibody [Clone ID: AT2D12]

AM50016PU-N

USD 340.00

2 Weeks

GCLM mouse monoclonal antibody, clone AT2D12, Purified

Applications	ELISA, FC, IF, WB
Reactivities	Human

Glutathione Peroxidase 1 (GPX1) Rabbit Polyclonal Antibody

AP23590PU-N

USD 440.00

2 Weeks

Glutathione Peroxidase 1 (GPX1) rabbit polyclonal antibody

Applications	IF, IHC, WB
Reactivities	Human
Immunogen	KLH synthetic peptide containing a sequence corresponding to a region within amino acids 127 and 193 of Glutathione peroxidase 1.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GCLC (N-term) Rabbit Polyclonal Antibody

AP51800PU-N

USD 450.00

2 Weeks

GCLC (N-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IF, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 6-34 amino acids from the N-terminal region of Human GCLC / GLCLC

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Glutathione Reductase (GSR) (C-term) Rabbit Polyclonal Antibody

AP51963PU-N

USD 450.00

2 Weeks

Glutathione Reductase (GSR) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	FC, IF, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 387-416 amino acids from the C-terminal region of human Glutathione reductase.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Glutathione S Transferase alpha 1 (GSTA1) Rabbit Polyclonal Antibody

TA308419

USD 415.00

5 Days

Rabbit polyclonal antibody to GSTA1 (glutathione S-transferase A1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

IDH2 Rabbit Polyclonal Antibody

TA319664

USD 430.00

2 Weeks

Rabbit Polyclonal IDH2 Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	IDH2 antibody was raised against a 17 amino acid synthetic peptide near the amino terminus of human IDH2.

1 / 3

2 / 3

3 / 3

Previous Next

GCLM Rabbit Polyclonal Antibody

TA325093

USD 450.00

5 Days

Rabbit polyclonal GCLM Antibody (C-term)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	This GCLM antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 246-274 amino acids from the C-terminal region of human GCLM.

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

GST3 (GSTP1) (C-term) Rabbit Polyclonal Antibody

AP23405PU-N

USD 405.00

2 Weeks

GST3 (GSTP1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Immunogen	A peptide mapping at the C-terminus of GSTpi of human origin

PGD Rabbit Polyclonal Antibody

TA308104

USD 415.00

5 Days

Rabbit Polyclonal antibody to PGD (phosphogluconate dehydrogenase)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Recombinant fragment corresponding to a region within amino acids 1 and 201 of PGD (Uniprot ID#P52209)

1 / 3

2 / 3

3 / 3

Previous Next

GST3 (GSTP1) Rabbit Polyclonal Antibody

TA308806

USD 415.00

5 Days

Rabbit polyclonal antibody to glutathione transferase (glutathione S-transferase pi 1)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	Synthetic peptide corresponding to a region within amino acids 1 and 63 of GSTP1 (Uniprot ID#P09211)

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

GST3 (GSTP1) Rabbit Polyclonal Antibody

TA324758

USD 450.00

5 Days

Rabbit polyclonal GSTP1 Antibody (C-term)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	This GSTP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 165-192 amino acids from the C-terminal region of human GSTP1.

1 / 3

2 / 3

3 / 3

Previous Next

RRM2 Rabbit Polyclonal Antibody

TA327571

USD 345.00

3 Weeks

RRM2 Rabbit Polyclonal Antibody

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Recombinant protein of human RRM2

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

IDH2 Rabbit Polyclonal Antibody

TA336931

USD 424.00

5 Days

Rabbit Polyclonal IDH2 Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide made to a C-terminal portion of the human IDH2 protein (between residues 375-452) [UniProt P48735].

1 / 3

2 / 3

3 / 3

Previous Next

Glutathione Reductase (GSR) Rabbit Polyclonal Antibody

TA336225

USD 375.00

5 Days

Rabbit Polyclonal Anti-GSR Antibody

Applications	IF, WB
Reactivities	Human, Mouse, Zebrafish
Conjugation	Unconjugated
Immunogen	The immunogen for Anti-GSR Antibody: synthetic peptide directed towards the N terminal of human GSR. Synthetic peptide located within the following region: PTIEVSGKKYTAPHILIATGGMPSTPHESQIPGASLGITSDGFFQLEELP

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Isocitrate dehydrogenase (IDH1) Mouse Monoclonal Antibody [Clone ID: OTI2H9]

CF500610

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) IDH1 mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]

CF501286

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: OTI1G1]

CF501546

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) ODC1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI8A10]

CF501831

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI8A10 (formerly 8A10)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI3B6]

CF501832

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI3B6 (formerly 3B6)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI7A1]

CF501864

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI7A1 (formerly 7A1)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI9A1]

CF501881

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)

Applications	FC, IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI4F9]

CF501882

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI4F9 (formerly 4F9)

Applications	FC, IF, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody [Clone ID: OTI6C4]

CF501883

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSTT2 mouse monoclonal antibody, clone OTI6C4 (formerly 6C4)

Applications	IF, IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Glutathione Synthetase (GSS) Mouse Monoclonal Antibody [Clone ID: OTI2F2]

CF501936

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GSS mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 
• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI2G8]

CF503091

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2G8 (formerly 2G8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI 1A7]

CF503095

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI 1A7 (formerly 1A7)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI5C12]

CF503096

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5C12 (formerly 5C12)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3A8]

CF503097

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3A8 (formerly 3A8)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI5F2]

CF503098

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5F2 (formerly 5F2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI3C9]

CF503099

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI5E5]

CF503100

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI5E5 (formerly 5E5)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI2H1]

CF503101

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI1G7]

CF503102

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI1G7 (formerly 1G7)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Spermine synthase (SMS) Mouse Monoclonal Antibody [Clone ID: OTI 5F9]

CF503112

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) SMS mouse monoclonal antibody, clone OTI 5F9 (formerly 5F9)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

PGD Mouse Monoclonal Antibody [Clone ID: OTI2A5]

CF505578

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PGD mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Isocitrate dehydrogenase (IDH1) Mouse Monoclonal Antibody [Clone ID: OTI2H9]

TA500610

USD 379.00

In Stock

Anti-IDH1 (Isocitrate Dehydrogenase 1) mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Isocitrate dehydrogenase (IDH1) Mouse Monoclonal Antibody [Clone ID: OTI2H9]

TA500610S

USD 159.00

In Stock

Anti-IDH1 (Isocitrate Dehydrogenase 1) mouse monoclonal antibody, clone OTI2H9 (formerly 2H9)

Applications	IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 
• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]

TA501286

USD 379.00

In Stock

ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G6]

TA501286AM

USD 420.00

4 Weeks

ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Biotin

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G6]

TA501286BM

USD 420.00

4 Weeks

ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	HRP

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: OTI1G6]

TA501286S

USD 159.00

In Stock

ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications	FC, IF, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody [Clone ID: OTI1G1]

TA501546

USD 379.00

In Stock

Anti-ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1G1]

TA501546AM

USD 420.00

4 Weeks

Anti-ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), Biotinylated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	Biotin

• 

1 / 3

2 / 3

3 / 3

Previous Next

Ornithine Decarboxylase (ODC1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1G1]

TA501546BM

USD 420.00

4 Weeks

Anti-ODC1 (Ornithine Decarboxylase) mouse monoclonal antibody, clone OTI1G1 (formerly 1G1), HRP conjugated

Applications	FC, IF, WB
Reactivities	Human, Mouse, Rat
Conjugation	HRP

• 

1 / 3

2 / 3

3 / 3

Previous Next

1 - 50 of 126 results

Page 1 of 3