Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-HSPA1A(HSP70) antibody, Loading control
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 308 and 569 of HSP70 1A |
Rabbit polyclonal Hsp70 Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat, Beluga, Cow, Dog, Fish (carp), Guinea Pig, Hamster, Monkey, Pig, Sheep, Coral, Tomato, Tobacco, Spiny Dogfish Shark (Squalus acanthias), Atlantic Hagfish (Myxine glutinosa) |
| Conjugation | Unconjugated |
| Immunogen | Full length human protein Hsp70 |
Rabbit Polyclonal Anti-SF3A1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SF3A1 antibody: synthetic peptide directed towards the N terminal of human SF3A1. Synthetic peptide located within the following region: QQTTQQQLPQKVQAQVIQETIVPKEPPPEFEFIADPPSISAFDLDVVKLT |
Rabbit anti-SFRS1 Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SFRS1 |
Rabbit Polyclonal antibody to SART1 (squamous cell carcinoma antigen recognized by T cells)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 137 and 447 of SART1 (Uniprot ID#O43290) |
Rabbit anti-HSPA1A Polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | N term –peptide of human HSPA1A |
HSP70-1A (HSPA1A) mouse monoclonal antibody, clone SJ-70, Purified
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal antibody to NHP2-like protein 1 (NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 128 of NHP2-like protein 1 (Uniprot ID#P55769) |
Rabbit polyclonal antibody to hnRNP C1/C2 (heterogeneous nuclear ribonucleoprotein C (C1/C2))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 142 of hnRNP C1/C2 |
PRP19 (PRPF19) (C-term) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic C-terminal peptide of human Prp19p protein (aa 182-192) conjugated to KLH |
Rabbit Polyclonal Acinus Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Acinus antibody was raised against a 35 amino acid peptide near the center of human Acinus. The immunogen is located within amino acids 760 - 810 of Acinus. |
Rabbit Polyclonal antibody to PUF60 (poly-U binding splicing factor 60KDa)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 346 and 523 of PUF60 (Uniprot ID#Q9UHX1) |
Rabbit polyclonal anti-SFRS5 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | he antiserum was produced against synthesized peptide derived from internal of human SFRS5. |
Rabbit Polyclonal Acinus Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Acinus antibody was raised against a peptide corresponding to amino acids near the C-terminus of the cleaved active peptide p17, which are identical to those of mouse Acinus. The immunogen is located within amino acids 1050 - 1100 of Acinus. |
Rabbit Polyclonal Acinus Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Acinus antibody was raised against a peptide corresponding to amino acids near the carbosy terminus of human AcinusL, which are identical to those of mouse Acinus. |
Mouse Monoclonal Hsp70 (N-terminus) Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HSPA1A mouse monoclonal antibody, clone OTI5F3 (formerly 5F3)
| Applications | FC, IF, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Active filters
Applications
- IF
Pathways
- Spliceosome
Filter by
Category
Target Symbol
Reactivities
- Human (81)
- Mouse (61)
- Rat (55)
- Dog (27)
- Monkey (22)
- Bovine (7)
- Hamster (4)
- Pig (4)
- Sheep (4)
- Guinea Pig (3)
- Beluga (2)
- Carp (2)
- Chicken (2)
- Cow (2)
- Drosophila (2)
- Rabbit (2)
- Zebrafish (2)
- C. elegans (1)
- Canine (1)
- Chimpanzee (1)
- Coral (1)
- Dogfish (1)
- Fish (1)
- Hagfish (1)
- Rhesus Monkey (1)
- Tobacco (1)
- Tomato (1)
- Xenopus (1)
- Yeast (1)