Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal antibody to MX1 (myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 194 and 475 of MX1 (Uniprot ID#P20591) |
GPR44 / CRTH2 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR44 / CRTH2 antibody was raised against synthetic 33 amino acid peptide from N-terminal extracellular domain of human GPR44 / CRTH2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (91%); Dog, Pig (88%); Rabbit (85%); Bovine (82%). |
B1R / BDKRB1 Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | B1R / BDKRB1 antibody was raised against synthetic 16 amino acid peptide from 1st cytoplasmic domain of human BDKRB1. Percent identity with other species by BLAST analysis: Human (100%); Gorilla, Gibbon, Monkey (94%); Horse (81%). |
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Active filters
Applications
- IHC
Clonalities
- Polyclonal
Families
- Druggable Genome
Availabilities
- In Stock
Filter by
Target Symbol
- AKT1 (8)
- PAK1 (7)
- GCG (6)
- RAB27A (6)
- APAF1 (5)
- ATF2 (5)
- BRAF (5)
- CASP7 (5)
- CASP9 (5)
- DEFA1 (5)
- HSPD1 (5)
- JUN (5)
- MUC1 (5)
- NR3C1 (5)
- ADD1 (4)
- AFP (4)
- AKR1B1 (4)
- AMD1 (4)
- BAD (4)
- BAX (4)
- BIRC6 (4)
- CCNB1 (4)
- CCNE1 (4)
- CFLAR (4)
- ERBB3 (4)
- ESR1 (4)
- GEMIN2 (4)
- GNAS (4)
- GPT (4)
- GSK3A (4)
- HDAC1 (4)
- HDAC2 (4)
- JUND (4)
- JUP (4)
- KAT5 (4)
- LOX (4)
- MAP2K6 (4)
- MME (4)
- NTRK1 (4)
- PMS2 (4)
- RAB25 (4)
- RAF1 (4)
- RPS6KB1 (4)
- SCARB1 (4)
- SRC (4)
- STAT5B (4)
- TRPC6 (4)
- XRCC6 (4)
- AATK (3)
- ACVR1C (3)
- ADM (3)
- ADRB3 (3)
- AGT (3)
- AHR (3)
- AK1 (3)
- AKAP8 (3)
- AKAP8L (3)
- AKT2 (3)
- ALDH3B1 (3)
- ALDH4A1 (3)
- ALDOB (3)
- ALK (3)
- APLNR (3)
- APOH (3)
- APP (3)
- AQP3 (3)
- ARRB1 (3)
- BCL2L11 (3)
- BMP3 (3)
- BMX (3)
- BRCA1 (3)
- BSG (3)
- CAMK2B (3)
- CASP1 (3)
- CCND3 (3)
- CCR6 (3)
- CDK5 (3)
- CDKN1A (3)
- CDKN2A (3)
- CDKN2C (3)
- CFTR (3)
- CIDEB (3)
- CREB1 (3)
- CSNK1A1 (3)
- CTSD (3)
- CXCR4 (3)
- CYP19A1 (3)
- DCTN1 (3)
- DUSP6 (3)
- EIF2AK3 (3)
- FADD (3)
- FASLG (3)
- FGFR2 (3)
- FOS (3)
- FZD8 (3)
- GAB2 (3)
- GAD1 (3)
- GJB6 (3)
- GRIK1 (3)
- GRIN1 (3)
Reactivities
- Human (3196)
- Mouse (2554)
- Rat (2034)
- Monkey (67)
- Dog (40)
- Bovine (37)
- Gorilla (28)
- Pig (27)
- Gibbon (20)
- Chicken (19)
- Rabbit (17)
- Horse (15)
- Canine (13)
- Xenopus (11)
- Chimpanzee (10)
- Cow (9)
- Hamster (9)
- Orang-Utan (8)
- X. tropicalis (8)
- Bat (7)
- Rhesus Monkey (6)
- Zebrafish (6)
- Guinea Pig (4)
- Primate (3)
- Porcine (2)
- Sheep (2)
- Feline (1)
- Ferret (1)
- Goat (1)
- Mink (1)
Antibody Hosts
Isotypes
Conjugates
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (316)
- Metabolic pathways (257)
- MAPK signaling pathway (235)
- Focal adhesion (171)
- Neurotrophin signaling pathway (157)
- Chemokine signaling pathway (153)
- Cytokine-cytokine receptor interaction (144)
- Neuroactive ligand-receptor interaction (144)
- Regulation of actin cytoskeleton (135)
- ErbB signaling pathway (126)
- Prostate cancer (126)
- Apoptosis (115)
- Insulin signaling pathway (115)
- Toll-like receptor signaling pathway (115)
- Cell cycle (112)
- T cell receptor signaling pathway (112)
- Chronic myeloid leukemia (110)
- Colorectal cancer (107)
- Jak-STAT signaling pathway (107)
- Wnt signaling pathway (104)
- Progesterone-mediated oocyte maturation (103)
- Pancreatic cancer (101)
- Calcium signaling pathway (95)
- Acute myeloid leukemia (92)
- Oocyte meiosis (90)
- Small cell lung cancer (89)
- Renal cell carcinoma (88)
- Endocytosis (86)
- GnRH signaling pathway (84)
- Alzheimer's disease (83)
- Axon guidance (82)
- Glioma (82)
- B cell receptor signaling pathway (81)
- Melanoma (81)
- Natural killer cell mediated cytotoxicity (79)
- p53 signaling pathway (79)
- Adipocytokine signaling pathway (78)
- Fc gamma R-mediated phagocytosis (78)
- Endometrial cancer (77)
- Non-small cell lung cancer (76)
- Leukocyte transendothelial migration (75)
- VEGF signaling pathway (74)
- Melanogenesis (72)
- Fc epsilon RI signaling pathway (71)
- Vascular smooth muscle contraction (68)
- Long-term potentiation (66)
- Huntington's disease (62)
- TGF-beta signaling pathway (62)
- Adherens junction (61)
- Amyotrophic lateral sclerosis (ALS) (61)
- Gap junction (61)
- NOD-like receptor signaling pathway (58)
- Tight junction (58)
- Epithelial cell signaling in Helicobacter pylori infection (56)
- mTOR signaling pathway (55)
- Bladder cancer (54)
- Ubiquitin mediated proteolysis (54)
- Type II diabetes mellitus (51)
- Long-term depression (47)
- RIG-I-like receptor signaling pathway (47)
- Dilated cardiomyopathy (45)
- Glycolysis / Gluconeogenesis (42)
- Purine metabolism (42)
- Cell adhesion molecules (CAMs) (39)
- Complement and coagulation cascades (37)
- Hematopoietic cell lineage (37)
- ECM-receptor interaction (36)
- Hypertrophic cardiomyopathy (HCM) (35)
- Lysosome (35)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (32)
- Thyroid cancer (32)
- Basal cell carcinoma (31)
- Pathogenic Escherichia coli infection (31)
- Phosphatidylinositol signaling system (31)
- PPAR signaling pathway (30)
- Notch signaling pathway (29)
- Parkinson's disease (29)
- Metabolism of xenobiotics by cytochrome P450 (28)
- Drug metabolism - cytochrome P450 (27)
- Hedgehog signaling pathway (27)
- Viral myocarditis (26)
- Arginine and proline metabolism (25)
- Type I diabetes mellitus (25)
- ABC transporters (24)
- Cytosolic DNA-sensing pathway (24)
- Vibrio cholerae infection (22)
- Alanine (21)
- Fructose and mannose metabolism (21)
- Prion diseases (21)
- Retinol metabolism (21)
- Taste transduction (21)
- aspartate and glutamate metabolism (21)
- Glycerolipid metabolism (20)
- Antigen processing and presentation (19)
- Butanoate metabolism (19)
- Fatty acid metabolism (19)
- Pyruvate metabolism (19)
- Tyrosine metabolism (19)
- Valine (18)
- Arachidonic acid metabolism (17)
- Base excision repair (17)
- Inositol phosphate metabolism (17)
- Renin-angiotensin system (16)
- SNARE interactions in vesicular transport (16)
- leucine and isoleucine degradation (16)
- Androgen and estrogen metabolism (15)
- Galactose metabolism (15)
- Homologous recombination (15)
- Autoimmune thyroid disease (14)
- Cysteine and methionine metabolism (14)
- Histidine metabolism (14)
- Olfactory transduction (14)
- Pentose phosphate pathway (14)
- Tryptophan metabolism (14)
- Graft-versus-host disease (13)
- Mismatch repair (13)
- Primary immunodeficiency (13)
- Systemic lupus erythematosus (13)
- Allograft rejection (12)
- Cardiac muscle contraction (12)
- Sphingolipid metabolism (11)
- Starch and sucrose metabolism (11)
- Citrate cycle (TCA cycle) (10)
- DNA replication (10)
- Dorso-ventral axis formation (10)
- Glutathione metabolism (10)
- Non-homologous end-joining (10)
- Pyrimidine metabolism (10)
- Regulation of autophagy (10)
- beta-Alanine metabolism (10)
- Amino sugar and nucleotide sugar metabolism (9)
- C21-Steroid hormone metabolism (9)
- Linoleic acid metabolism (9)
- Maturity onset diabetes of the young (9)
- Nucleotide excision repair (9)
- Propanoate metabolism (9)
- Drug metabolism - other enzymes (8)
- Nitrogen metabolism (8)
- Phenylalanine metabolism (8)
- Glycerophospholipid metabolism (7)
- Lysine degradation (7)
- Primary bile acid biosynthesis (7)
- RNA degradation (7)
- Ascorbate and aldarate metabolism (6)
- Other glycan degradation (6)
- Pentose and glucuronate interconversions (6)
- Porphyrin and chlorophyll metabolism (6)
- Proteasome (6)
- Riboflavin metabolism (6)
- Ribosome (6)
- Folate biosynthesis (5)
- Limonene and pinene degradation (5)
- Oxidative phosphorylation (5)
- Pantothenate and CoA biosynthesis (5)
- Taurine and hypotaurine metabolism (5)
- Asthma (4)
- Fatty acid biosynthesis (4)
- Glycine (4)
- Glycosaminoglycan degradation (4)
- Nicotinate and nicotinamide metabolism (4)
- Selenoamino acid metabolism (4)
- Terpenoid backbone biosynthesis (4)
- leucine and isoleucine biosynthesis (4)
- serine and threonine metabolism (4)
- Basal transcription factors (3)
- Biosynthesis of unsaturated fatty acids (3)
- Circadian rhythm - mammal (3)
- Steroid biosynthesis (3)
- Synthesis and degradation of ketone bodies (3)
- Aminoacyl-tRNA biosynthesis (2)
- Caffeine metabolism (2)
- D-Glutamine and D-glutamate metabolism (2)
- Ether lipid metabolism (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Vitamin B6 metabolism (2)
- alpha-Linolenic acid metabolism (2)
- Chondroitin sulfate biosynthesis (1)
- Glycosphingolipid biosynthesis - ganglio series (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Methane metabolism (1)
- One carbon pool by folate (1)
- Phenylalanine (1)
- Spliceosome (1)
- Sulfur metabolism (1)
- Thiamine metabolism (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- tyrosine and tryptophan biosynthesis (1)