Antibodies

Jump to Filters
View as table Download
CD16 (FCGR3A) Mouse Monoclonal Antibody [Clone ID: DJ130c]
AM01321PU-N

USD 475.00

5 Days

CD16 (FCGR3A) mouse monoclonal antibody, clone DJ130c, Purified

Applications FC, IHC
Reactivities Human
CD16 (FCGR3A) Mouse Monoclonal Antibody [Clone ID: c127]
AM26063PU-N

USD 435.00

2 Weeks

CD16 (FCGR3A) mouse monoclonal antibody, clone c127, Aff - Purified

Applications FC, IHC, IP
Reactivities Human
CD16 (FCGR3A) Mouse Monoclonal Antibody [Clone ID: GRM1]
AM08159PU-N

USD 190.00

3 Days

CD16 (FCGR3A) mouse monoclonal antibody, clone GRM1, Purified

Applications FC, IHC, IP, WB
Reactivities Human
Gelsolin (GSN) Mouse Monoclonal Antibody [Clone ID: 3G5]
AM31077PU-N

USD 480.00

2 Weeks

Gelsolin (GSN) mouse monoclonal antibody, clone 3G5, Purified

Applications ELISA, IHC, IP, WB
Reactivities Human
Gelsolin (GSN) (161-369) Rabbit Polyclonal Antibody
AP23589PU-N

USD 440.00

2 Weeks

Gelsolin (GSN) (161-369) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 161 and 369 of Gelsolin.
Amphiphysin (AMPH) Rabbit Polyclonal Antibody
TA308324

USD 415.00

5 Days

Rabbit polyclonal antibody to Amphiphysin (amphiphysin)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 194 of Amphiphysin (Uniprot ID#P49418)
Gelsolin (GSN) Mouse Monoclonal Antibody [Clone ID: GEL-42]
AM20623PU-N

USD 405.00

2 Weeks

Gelsolin (GSN) mouse monoclonal antibody, clone GEL-42, Purified

Applications IHC, WB
Reactivities Human, Rabbit
Gelsolin (GSN) Rabbit Polyclonal Antibody
TA327454

USD 345.00

3 Weeks

GSN Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human GSN
Gelsolin (GSN) Rabbit Polyclonal Antibody
TA336242

USD 375.00

5 Days

Rabbit Polyclonal Anti-GSN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GSN Antibody: synthetic peptide directed towards the C terminal of human GSN. Synthetic peptide located within the following region: KPMIIYKGGTSREGGQTAPASTRLFQVRANSAGATRAVEVLPKAGALNSN
Amphiphysin (AMPH) Rabbit Polyclonal Antibody
TA321384

USD 345.00

In Stock

Anti-AMPH Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human amphiphysin
Amphiphysin (AMPH) Rabbit Polyclonal Antibody
TA321385

USD 345.00

In Stock

Anti-AMPH Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human amphiphysin
Gelsolin (GSN) Rabbit Polyclonal Antibody
TA323717

USD 345.00

In Stock

Anti-GSN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin
Gelsolin (GSN) Rabbit Polyclonal Antibody
TA323718

USD 345.00

In Stock

Anti-GSN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 768-782 amino acids of Human gelsolin
CD16 (FCGR3A) Rabbit Polyclonal Antibody
TA350080

USD 345.00

In Stock

Rabbit Polyclonal Anti-FCGR3A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human FCGR3A