Rabbit polyclonal anti-Cyclin E1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin E1. |
Rabbit polyclonal anti-Cyclin E1 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Cyclin E1. |
Mouse Monoclonal anti-P53 Antibody
Applications | IHC, WB |
Reactivities | Human, non-human primates |
Conjugation | Unconjugated |
USD 300.00
2 Weeks
p53 (TP53) (Wild type + Mutant) (20-31) mouse monoclonal antibody, clone Bp53-11, Aff - Purified
Applications | ELISA, IF, IHC, IP, WB |
Reactivities | Human |
MDM2 mouse monoclonal antibody, clone 1A7, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Rabbit Polyclonal Antibody against MDM2 (C-term)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |
Rabbit polyclonal anti-MDM2 antibody
Applications | IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human MDM2. |
Rabbit anti-TP53 Polyclonal Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TP53 |
p53 (TP53) mouse monoclonal antibody, clone B-P3, Azide Free
Applications | FC, IHC, IP, WB |
Reactivities | Human |
Rabbit polyclonal Cyclin E1 (Thr395) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-TP-P-P). |
Modifications | Phospho-specific |
Rabbit polyclonal MDM4 (Ser367) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MDM4 around the phosphorylation site of serine 367 (T-I-SP-A-P). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-p73 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human p73. |
Rabbit polyclonal TP73 Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This TP73 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 288-317 amino acids from the Central region of human TP73. |
Rabbit polyclonal p53 (Ab-15) antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p53 around the phosphorylation site of Serine 15. |
Rabbit polyclonal p53 (Phospho-Ser15) antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of Serine 15 (P-L-SP-Q-E). |
Modifications | Phospho-specific |
p53 (TP53) mouse monoclonal antibody, clone IMD-53, Purified
Applications | IF, IHC, WB |
Reactivities | Human |
MDM2 pSer166 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthesized phosphopeptide derived from human MDM2 around the phosphorylation site of Serine 166 (A-I-SP-E-T) |
MDM2 pSer166 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Immunogen | Synthesized phosphopeptide derived from human MDM2 around the phosphorylation site of Serine 166 (A-I-SP-E-T) |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 341-390 of Human p53. |
Rabbit Polyclonal Antibody against TP53 (T55)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-62 amino acids from human p53. |
Rabbit Polyclonal ATM Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | ATM antibody was raised against a peptide corresponding to 14 amino acids near the carboxy terminus of human ATM. |
Rabbit polyclonal Phospho-p53(T18) Antibody
Applications | Dot, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding T18 of human p53. |
Modifications | Phospho-specific |
Rabbit polyclonal p53 Antibody (S315)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This p53 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 293-322 amino acids from human p53. |
Rabbit polyclonal p53 (Phospho-Thr387) antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human p53 around the phosphorylation site of threonine 387 (F-K-TP-E-G). |
Modifications | Phospho-specific |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal ATM Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A fragment of the human ATM protein corresponding to the C-terminus (within the last third of the protein sequence). [UniProt# Q13315] |
p73 (TP73) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
p53 (TP53) pSer20 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
p73 (TP73) (alpha) (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A peptide mapping at the C-terminal end of human P73a |
Rabbit polyclonal Phospho-p53(S20) Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This p53 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S20 of human p53. |
Modifications | Phospho-specific |
Rabbit Polyclonal Cyclin E1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Cyclin E1. |
Rabbit Polyclonal Cyclin E1 (Thr395) Antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human Cyclin E1 around the phosphorylation site of Threonine 395. |
Modifications | Phospho-specific |
Rabbit Polyclonal MDM2 (Ser166) Antibody (Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human MDM2 around the phosphorylation site of Sersine 166. |
Modifications | Phospho-specific |
Rabbit Polyclonal p53 Antibody
Applications | IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against a synthesized A synthesized peptide derived from human p53. |
Mouse monoclonal p53 Antibody
Applications | IHC, WB |
Reactivities | Human |
Mouse Monoclonal p73 Antibody (5B429)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Mouse Monoclonal Delta Np73 Antibody (38C674.2)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Mouse monoclonal Anti-MDM2 Clone SMP14
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti p53 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the N-terminus of human p53 protein |
Rabbit anti P53(pS15) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the epitope –PLSQE- at a phosphorylation site at serine 15 of human p53 protein |
Rabbit anti P53(pS37) Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to the epitope –LPSPH- at a phosphorylation site at serine 37 of human p53 protein |
ATM pSer1981 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Immunogen | Synthetic phosphopeptide derived from human ATM around the phosphorylation site of Serine 1981. |
p53 (TP53) pSer37 rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
ATM rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 1957-2006 of Human ATM. |
p53 (TP53) rabbit polyclonal antibody, Aff - Purified
Applications | IHC |
Reactivities | Human |