Antibodies

View as table Download

Rabbit anti-PRKCA Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human PRKCA

Rabbit monoclonal antibody against PTEN Phospho (Ser380) (clone EPR2062Y ) (Phospho-Specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Modifications Phospho-specific

Phospho-PRKCB-T641 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T641 of human PRKCB
Modifications Phospho-specific

PLCB1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PLCB1

Mouse anti pTEN Monoclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E).
Modifications Phospho-specific

Rabbit monoclonal antibody against INPP4A(clone EP3425(2))

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3

Rabbit polyclonal PLCG1 (Ab-771) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-Y-G-A).

Rabbit polyclonal PTEN (Ab-370) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of serine 370.

Rabbit polyclonal anti-IPPK antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human IPPK.

Rabbit polyclonal anti-DGKH antibody

Applications IF, IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human DGKH.

INPP5J / PIB5PA Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Rabbit, Rat, Gorilla, Dog, Pig, Horse, Gibbon
Conjugation Unconjugated
Immunogen INPP5J / PIB5PA antibody was raised against synthetic 18 amino acid peptide from near C-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Platypus (83%).

Anti-PTEN (Phospho-Ser380/Thr382/Thr383) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 380/382/383 (R-Y-S(p)-D-T(p)-T(p)-D-S) derived from Human PTEN.
Modifications Phospho-specific

Rabbit polyclonal PI3KC3 Antibody (S34)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 14-39 amino acids from human PI3KC3.

Rabbit polyclonal PIK3CG antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIK3CG.

Rabbit polyclonal antibody to INPP1 (inositol polyphosphate-1-phosphatase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 3 and 269 of INPP1 (Uniprot ID#P49441)

Rabbit polyclonal anti-PIK3R5 antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PIK3R5.

Rabbit polyclonal PI3KCD Antibody (C-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 687-717 amino acids from the C-terminal region of human PI3KCD.

Rabbit polyclonal PI3KCD Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PI3KCD antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 85-114 amino acids from the N-terminal region of human PI3KCD.

Rabbit polyclonal PLCB2 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PLCB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 174-202 amino acids from the N-terminal region of human PLCB2.

Rabbit polyclonal PI3-kinase p85-a (Phospho-Tyr607) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PI3-kinase p85-α around the phosphorylation site of tyrosine 607 (D-Q-YP-S-L).
Modifications Phospho-specific

PKC alpha (PRKCA) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to the C-terminal of human PKCa

Rabbit Polyclonal antibody to INPP5B (inositol polyphosphate-5-phosphatase, 75kDa)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 699 and 949 of INPP5B (Uniprot ID#P32019)

Rabbit Polyclonal antibody to PKC alpha (protein kinase C, alpha)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 250 of PKC alpha (Uniprot ID#P17252)

Rabbit anti-PTEN (Phospho-Ser380/Thr382/Thr383) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse and Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanPTEN around the phosphorylation site of serine 380 and threonine 382/383(R-Y-SP-D-TP-TP-D-S).
Modifications Phospho-specific

Rabbit polyclonal PLCG1 (Tyr771) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PLCG1 around the phosphorylation site of tyrosine 771 (P-D-YP-G-A)
Modifications Phospho-specific

Rabbit polyclonal PTEN(Ab-380/382/383) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PTEN around the phosphorylation site of Serine 380 and Threonine 382/383.

Rabbit polyclonal PLC-beta (Ser1105) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PLC-β around the phosphorylation site of serine 1105 (N-N-SP-I-S).
Modifications Phospho-specific

Rabbit Polyclonal Anti-DGKH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-DGKH antibody: synthetic peptide directed towards the middle region of human DGKH. Synthetic peptide located within the following region: DLDSVDGYSEKCVMNNYFGIGLDAKISLEFNNKREEHPEKCRSRTKNLMW

Rabbit anti pTEN Polyclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to the C-terminus of human PTEN protein. This sequence is identical among human, mouse, rat origins.

SHIP (INPP5D) (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to C-terminal of human SHIP-1

Goat Polyclonal Antibody against PIK3CA

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HQWLKDKNKGEIYD, from the internal region of the protein sequence according to NP_006209.2.

Goat Anti-PIK3C2A Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TVKWYQLTAATYL, from the C Terminus of the protein sequence according to NP_002636.2.

Rabbit polyclonal anti-CALML5 (CABP7) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CALML5.

Rabbit polyclonal anti-PIP5K antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human PIP5K.

INPP5J / PIB5PA Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gorilla, Horse, Human, Pig
Immunogen INPP5J / PIB5PA antibody was raised against synthetic 19 amino acid peptide from internal region of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Elephant, Horse, Pig (100%); Gibbon, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Panda, Rabbit (95%); Bat, Platypus (89%).

INPP5J / PIB5PA Rabbit Polyclonal (N-Terminus) Antibody

Applications IHC
Reactivities Human, Gorilla
Conjugation Unconjugated
Immunogen INPP5J / PIB5PA antibody was raised against synthetic 15 amino acid peptide from N-terminus of human INPP5J / PIB5PA. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (87%); Marmoset (80%).

Phospho-PLCG2-Y1217 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y1217 of human PLCG2
Modifications Phospho-specific

Anti-PRKCA rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha

Anti-PRKCA rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 339-597 amino acids of human protein kinase C, alpha

Anti-PTEN rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 381-396 amino acids of human phosphatase and tensin homolog

Anti-PIK3R1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 113-301 amino acids of human phosphoinositide-3-kinase, regulatory subunit 1 (alpha)

Rabbit Polyclonal Anti-PIKFYV Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PIKFYV

Rabbit Polyclonal Anti-PIP5K1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PIP5K1A

Rabbit Polyclonal Anti-PIP5K1B Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PIP5K1B

Rabbit Polyclonal Anti-PIP4K2A Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PIP4K2A

Rabbit Polyclonal Anti-PLCZ1 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PLCZ1

Rabbit Polyclonal Anti-PIK3C3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PIK3C3