Antibodies

View as table Download

Rabbit anti-ACAT1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ACAT1

Rabbit Polyclonal Anti-HMGCS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HMGCS1 antibody: synthetic peptide directed towards the middle region of human HMGCS1. Synthetic peptide located within the following region: KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA

Goat Polyclonal Antibody against BDH2 / DHRS6 (aa 60 to 71)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TKKKQIDQFANE, from the internal region of the protein sequence according to NP_064524.3.

Rabbit Polyclonal Anti-ACAT2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ACAT2 antibody: synthetic peptide directed towards the middle region of human ACAT2. Synthetic peptide located within the following region: SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR

ACAT1 (N-term) mouse monoclonal antibody, clone AT1.H11, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human
Immunogen Synthetic peptide

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide from Human ACAT1.
Epitope: Internal.

Rabbit Polyclonal antibody to HMGCL (3-hydroxymethyl-3-methylglutaryl-Coenzyme A lyase)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 325 of HMGCL (Uniprot ID#P35914)

ACAT1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Porcine, Rat
Immunogen Synthetic peptide

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: GHQDVMVAGGMESMSNVPYVMNRGSTPYGGVKLEDLIVKDGLTDVYNKIH

Rabbit Polyclonal Anti-ACAT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ACAT1 Antibody: synthetic peptide directed towards the middle region of human ACAT1. Synthetic peptide located within the following region: SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKL

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI5A2 (formerly 5A2)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ACAT2 mouse monoclonal antibody, clone OTI1B7 (formerly 1B7)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BDH2 mouse monoclonal antibody, clone OTI4G4 (formerly 4G4)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BDH2 mouse monoclonal antibody, clone OTI3G10 (formerly 3G10)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) BDH2 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-BDH1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human BDH1

Rabbit Polyclonal Anti-HMGCL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human HMGCL

Rabbit Polyclonal Anti-HMGCS1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HMGCS1

Rabbit Polyclonal Anti-HMGCS2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human HMGCS2

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP

Anti-ACAT2 mouse monoclonal antibody, clone OTI3A11 (formerly 3A11)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP

Anti-ACAT2 mouse monoclonal antibody, clone OTI5F7 (formerly 5F7)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Biotin

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation HRP

Anti-ACAT2 mouse monoclonal antibody, clone OTI1G6 (formerly 1G6)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin

ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP

ACAT2 mouse monoclonal antibody, clone OTI7B1 (formerly 7B1)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Biotin

Anti-ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation HRP

Anti-ACAT2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

Anti-ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Unconjugated

Anti-ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation Biotin

Anti-ACAT2 mouse monoclonal antibody, clone OTI3C9 (formerly 3C9), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Mouse, Rat, Dog
Conjugation HRP