Antibodies

View as table Download

Rabbit anti-PRKCA Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human PRKCA

Rabbit anti-CAMK4 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CAMK4

Phospho-PRKCB-T641 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T641 of human PRKCB
Modifications Phospho-specific

Rabbit Polyclonal Anti-RAF1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RAF1

Rabbit anti-PPP1CB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CB

PLCB1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PLCB1

Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M).
Modifications Phospho-specific

Rabbit anti-PRKACB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PRKACB

Rabbit Polyclonal Anti-MAP2K1 Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human MAP2K1

Rabbit Polyclonal antibody to PP1C gamma (protein phosphatase 1, catalytic subunit, gamma isozyme)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 2 and 227 of PP1C gamma (Uniprot ID#P36873)

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit anti-PPP1CA Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP1CA

Rabbit anti-GRIA1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GRIA1

Rabbit polyclonal Calmodulin (Thr79+Ser81) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Calmodulin around the phosphorylation site of threonine 79 and serine 81 (K-D-TP-D-SP-E-E).
Modifications Phospho-specific

Rabbit polyclonal Raf1 (Ab-621) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P).

Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C).
Modifications Phospho-specific

Rabbit polyclonal Raf1 (Tyr341) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Raf1 around the phosphorylation site of tyrosine 341 (S-Y-YP-W-E).
Modifications Phospho-specific

Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H).
Modifications Phospho-specific

Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E).
Modifications Phospho-specific

Rabbit polyclonal anti-P300/CBP antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human P300/CBP.

Rabbit polyclonal anti-PRKX antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PRKX.

NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913).

Rabbit polyclonal p90 RSK (Ab-573) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human p90 RSK around the phosphorylation site of threonine 573 (L-M-TP-P-C).

Rabbit polyclonal p90 RSK (Phospho-Thr573) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human P90RSK around the phosphorylation site of threonine 573 (L-M-TP-P-C).
Modifications Phospho-specific

Rabbit polyclonal NMDAR1 (Phospho-Ser890) antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human NMDAR1 around the phosphorylation site of serine 890 (A-S-SP-F-K).
Modifications Phospho-specific

Rabbit polyclonal RASH/RASK/RASN antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human RASH/RASK/RASN antibody.

Rabbit Polyclonal B-raf Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen B-raf antibody was raised against a 19 amino acid peptide near the center of human B-raf.

Rabbit Polyclonal Antibody against RPS6KA1 (S732)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This RPS6KA1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 710-735 amino acids from human RPS6KA1.

Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298)

Rabbit Polyclonal antibody to ARAF (v-raf murine sarcoma 3611 viral oncogene homolog)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 371 and 554 of A-RAF (Uniprot ID#P10398)

Rabbit polyclonal C-RAF (Thr269) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human C-RAF around the phosphorylation site of threonine 269 (S-T-TP-L-P).
Modifications Phospho-specific

Rabbit polyclonal anti-ADCY8 antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ADCY8.

Rabbit polyclonal Glutamate receptor 2 (Ab-880) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-S-V-K).

Rabbit polyclonal Glutamate receptor 2 (Ser880) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Glutamate receptor 2 around the phosphorylation site of serine 880 (I-E-SP-V-K).
Modifications Phospho-specific

Rabbit polyclonal PKA CAT (Ab-197) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C).

Anti-MAP2K2 (Phospho-Thr394) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 394 (P-G-T(p)-P-T) derived from Human MEK-2.
Modifications Phospho-specific

Anti-RPS6KA1 (Phospho-Thr348) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 348 (S-R-T(p)-P-R) derived from Human RPS6KA1.
Modifications Phospho-specific

Rabbit polyclonal MAPK1 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 154-183 amino acids from the Central region of human MAPK1.

Rabbit polyclonal MAPK3 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3.

Rabbit polyclonal MAPK1 Antibody (C-term)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MAPK1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 254-285 amino acids from the C-terminal region of human MAPK1.

Rabbit polyclonal B-RAF (Phospho-Thr599) antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human B-Raf around the phosphorylation site of threonine 598 (L-A-TP-V-K).
Modifications Phospho-specific

Rabbit Polyclonal Antibody against PRKCB1 (C-term)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated
Immunogen This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2.

Rabbit Polyclonal Antibody against MAP2K1 (T291)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This MAP2K1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 270-299 amino acids from human MAP2K1.

Rabbit polyclonal Raf1 (Ser621) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-SP-E-P).
Modifications Phospho-specific

Rabbit polyclonal PLC-beta (Ser1105) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human PLC-β around the phosphorylation site of serine 1105 (N-N-SP-I-S).
Modifications Phospho-specific

Anti-BRAF Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 591-607 amino acids of Human v-raf murine sarcoma viral oncogene homolog B1

Rabbit Polyclonal anti-ERK2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide mapping to the carboxy terminus of rat ERK2

Rabbit Polyclonal metabotropic Glutamate Receptor 1a Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide comprising internal residues of the human GluR1 alpha protein. Reacts with rat and mouse GluR1.

Rabbit Polyclonal metabotropic Glutamate Receptor 1a Antibody

Applications IHC, WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide comprising residues 1159-1171 [SSVPSSPVSESVL] of the human GluR1 protein.

Rabbit Polyclonal Anti-GRIN2A Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-GRIN2A antibody: synthetic peptide directed towards the middle region of human GRIN2A. Synthetic peptide located within the following region: DKIYTIDGEKEPGFHLDPPQFVENVTLPENVDFPDPYQDPSENFRKGDST