Rabbit Polyclonal Anti-DUSP10 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DUSP10 |
Rabbit Polyclonal Anti-DUSP10 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DUSP10 |
Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: TQTMHDLAGLGSETPKSQVGTLLFRSRSRLTHLSLSRRASESSLSSESSE |
Rabbit Polyclonal Anti-DUSP14 Antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DUSP14 |
Rabbit polyclonal MKP1 (Ab-359) antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MKP1 around the phosphorylation site of serine 359 (L-Q-SP-P-I). |
Rabbit polyclonal anti-DUSP6 antibody
Applications | IF, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human DUSP6. |
DUSP9 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
PPP3R2 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 9~29 amino acids from the N-terminal region of Human PPP3R2 / CBLP |
DUSP4 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Goat Polyclonal Antibody against DUSP16
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence AHEMIGTQIVTER-C, from the N Terminus of the protein sequence according to NP_085143.1. |
Rabbit Polyclonal antibody to DUSP7 (dual specificity phosphatase 7)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region within amino acids 258 and 350 of DUSP7 (Uniprot ID#Q16829) |
Rabbit Polyclonal antibody to PPP3CB (protein phosphatase 3, catalytic subunit, beta isozyme)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 228 of PPP3CB (Uniprot ID#P16298) |
Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A purified peptide conjugated to KLH |
DUSP1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
DUSP1 (+MKP2) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Calcineurin A (PPP3CA) (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of human Calcineurin (PPP3CA). |
PPP3CC (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | kLH conjugated synthetic peptide selected from the N-terminal region of Human PPP3CC. Epitope: N-Terminus. |
PPP3CC (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 17-45 amino acids from the N-terminal region of Human PPP3CC |
Rabbit Polyclonal antibody to DUSP3 (dual specificity phosphatase 3)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 185 of DUSP3 (Uniprot ID#P51452) |
Rabbit Polyclonal anti-p38 MAPK Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | peptide-KLH, C terminal |
Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CDC25B antibody: synthetic peptide directed towards the N terminal of human CDC25B. Synthetic peptide located within the following region: MEVPQPEPAPGSALSPAGVCGGAQRPGHLPGLLLGSHGLLGSPVRAAASS |
Rabbit polyclonal MKP1 (Ser359) antibody(Phospho-specific)
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MKP1 around the phosphorylation site of serine 359 (L-Q-SP-P-I). |
Modifications | Phospho-specific |
PTPRR Rabbit Polyclonal (aa249-265) Antibody
Applications | IHC |
Reactivities | Human |
Immunogen | PTPRR antibody was raised against synthetic peptide from human PTPRR. |
Anti-DUSP4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 197-394 amino acids of human dual specificity phosphatase 4 |
Anti-DUSP4 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 197-394 amino acids of human dual specificity phosphatase 4 |
Anti-DUSP1 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 355-367 amino acids of Human dual specificity phosphatase 1 |
Anti-DUSP8 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human dual specificity phosphatase 8 |
Anti-DUSP8 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human dual specificity phosphatase 8 |
Anti-DUSP6 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 206-381 amino acids of human dual specificity phosphatase 6 |
Anti-DUSP6 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 206-381 amino acids of human dual specificity phosphatase 6 |
Rabbit Polyclonal Anti-PPP3CA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PPP3CA |
Rabbit Polyclonal Anti-PTPN7 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PTPN7 |
Rabbit Polyclonal Anti-PTPN5 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PTPN5 |
Rabbit Polyclonal Anti-CDC25B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CDC25B |
Rabbit Polyclonal Anti-DUSP2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human DUSP2 |