Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal Anti-SOCS1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SOCS1 antibody: synthetic peptide directed towards the N terminal of human SOCS1. Synthetic peptide located within the following region: RRPEPSSSSSSSPAAPARPRPCPAVPAPAPGDTHFRTFRSHADYRRITRA |
Rabbit Polyclonal Anti-ANAPC7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ANAPC7 antibody: synthetic peptide directed towards the C terminal of human ANAPC7. Synthetic peptide located within the following region: ALSLDPNDQKSLEGMQKMEKEESPTDATQEEDVDDMEGSGEEGDLEGSDS |
Rabbit Polyclonal XIAP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | XIAP antibody was raised against a synthetic peptide corresponding to 13 amino acids at the C-terminus of human XIAP. The immunogen is located within amino acids 420 - 470 of XIAP. |
Rabbit polyclonal TTK (Ab-676) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human TTK around the phosphorylation site of threonine 676 (D-T-TP-S-V). |
Rabbit Polyclonal Antibody against MDM2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Rabbit Polyclonal cIAP Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | c-IAP antibody was raised against a synthetic peptide corresponding to 14 amino acids at the C-terminus of human c-IAP1 c-IAP antibody detects both c-IAP1 and c-IAP2. |
Rabbit Polyclonal antibody to DDB1 (damage-specific DNA binding protein 1, 127kDa)
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 749 and 1140 of DDB1 (Uniprot ID#Q16531) |
Rabbit polyclonal CDC16/APC6 (Ab-560) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
| Modifications | Phospho-specific |
FBXW7 / FBW7 Mouse Monoclonal (3D1) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit polyclonal ITCH (Tyr420) antibody(Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITCH around the phosphorylation site of tyrosine 420 (F-I-YP-G-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal BRCA1 (Ab-1423) antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human BRCA1 around the phosphorylation site of serine 1423 (H-G-SP-Q-P). |
Rabbit polyclonal CDC16/APC6 (Ser560) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CDC16/APC6 around the phosphorylation site of serine 560 (I-I-SP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-APC1 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human APC1. |
Rabbit polyclonal anti-Cbl-c antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity-purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 444-458 of Human Cbl-c. |
Rabbit polyclonal SYVN1 (HRD1) Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This SYVN1 (HRD1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 586-617 amino acids from the C-terminal region of human SYVN1 (HRD1). |
Rabbit polyclonal FBXW11 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This FBXW11 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 168-196 amino acids from the Central region of human FBXW11. |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Families
- Druggable Genome
Pathways
- Ubiquitin mediated proteolysis
Filter by
Category
Target Symbol
- UBE2G2 (30)
- MDM2 (29)
- FBXW7 (17)
- SOCS3 (17)
- ANAPC11 (15)
- BRCA1 (14)
- ERCC8 (10)
- UBOX5 (6)
- ANAPC1 (5)
- BIRC6 (5)
- PIAS1 (5)
- SMURF2 (5)
- VHL (5)
- ANAPC2 (4)
- BIRC2 (4)
- CDC16 (4)
- CUL3 (4)
- SIAH1 (4)
- STUB1 (4)
- TRAF6 (4)
- UBA7 (4)
- UBE2S (4)
- AIRE (3)
- ANAPC10 (3)
- CDC20 (3)
- CUL1 (3)
- DDB1 (3)
- PML (3)
- SOCS1 (3)
- UBE2N (3)
- UBE3B (3)
- XIAP (3)
- ANAPC4 (2)
- ANAPC5 (2)
- CDC27 (2)
- CUL2 (2)
- CUL5 (2)
- SKP1 (2)
- SYVN1 (2)
- UBR5 (2)
- ANAPC7 (1)
- BIRC3 (1)
- CBL (1)
- CBLC (1)
- CDC23 (1)
- ELOB (1)
- ELOC (1)
- FBXO2 (1)
- FBXW11 (1)
- ITCH (1)
- MAP3K1 (1)
- MID1 (1)
- NEDD4L (1)
- PRPF19 (1)
- RCHY1 (1)
- RNF7 (1)
- SMURF1 (1)
- TTK (1)
- UBE2B (1)
- UBE2C (1)
- WWP2 (1)