Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Mouse Monoclonal iNOS Antibody (4E5)
| Applications | ELISA, FC, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
TA336918 is a replacement of AM06772PU-N.
Rabbit Polyclonal antibody to RAC1 (ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1))
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 196 of RAC1 (Uniprot ID#P63000 isoform B) |
Rabbit Polyclonal Antibody against MAP3K5 (S83)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ASK1(MEKK5/MAP3K5) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 61-90 amino acids from human ASK1(MEKK5/MAP3K5). |
Rabbit anti-BAD (Phospho-Ser112) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanBAD around the phosphorylation site of serine 112 (H-S-SP-Y-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal p38 MAPK (Ab-322) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p38 MAPK around the phosphorylation site of tyreonine 322 (D-P-Y-D-Q). |
Rabbit anti-GRIA1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human GRIA1 |
Phospho-BCL2L1-S62 Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S62 of human BCL2L1 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CHP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CHP antibody: synthetic peptide directed towards the N terminal of human CHP. Synthetic peptide located within the following region: FTSLDKGENGTLSREDFQRIPELAINPLGDRIINAFFPEGEDQVNFRGFM |
Rabbit anti-BAD (Phospho-Ser136) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from mouse BAD around the phosphorylation site of serine136 (S-R-S[P]-A-P). |
| Modifications | Phospho-specific |
Rabbit anti-MAPK14 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MAPK14 |
Rabbit polyclonal MAP2K3/MKK3 (Ser189) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MKK3 around the phosphorylation site of Serine 189(V-D-SP-V-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H). |
| Modifications | Phospho-specific |
Mouse Anti-Human RAC1 Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913). |
Rabbit polyclonal Rab5 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Rab5 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 182-211 amino acids from the C-terminal region of human Rab5. |
Rabbit polyclonal CASP9 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This CASP9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 183-211 amino acids from the Central region of human CASP9. |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Pathways
- Amyotrophic lateral sclerosis (ALS)
Filter by
Category
Target Symbol
- TP53 (95)
- MAP2K3 (58)
- BCL2 (40)
- BID (24)
- CASP3 (18)
- BAX (16)
- PRPH (15)
- BAD (13)
- TNF (13)
- BCL2L1 (12)
- NEFH (12)
- CASP9 (11)
- CAT (11)
- CHP1 (11)
- MAPK13 (10)
- APAF1 (9)
- CASP1 (8)
- NEFM (8)
- GRIA2 (7)
- MAP2K6 (6)
- MAPK14 (6)
- NOS2 (6)
- SOD1 (5)
- GRIN1 (4)
- MAP3K5 (4)
- MAPK12 (4)
- NEFL (4)
- PPP3CA (4)
- ALS2 (3)
- CYCS (3)
- RAB5A (3)
- SLC1A2 (3)
- TNFRSF1A (3)
- TOMM40 (3)
- GRIN2A (2)
- GRIN2B (2)
- GRIN2C (2)
- GRIN2D (2)
- NOS3 (2)
- RAC1 (2)
- TNFRSF1B (2)
- CCS (1)
- DERL1 (1)
- GPX1 (1)
- GRIA1 (1)
- MAPK11 (1)
- PPP3CB (1)