Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Phospho-Caspase 9(S196) Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This Phospho-Caspase 9-S196 antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S196 of human caspase 9. |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CAV1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CAV1 antibody: synthetic peptide directed towards the N terminal of human CAV1. Synthetic peptide located within the following region: MSGGKYVDSEGHLYTVPIREQGNIYKPNNKAMADELSEKQVYDAHTKEID |
Rabbit Polyclonal Caspase-3 Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Caspase-3 antibody was raised against a 17 amino acid synthetic peptide near the center of human Caspase-3. |
Rabbit Polyclonal Anti-CXADR Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXADR antibody was raised against synthetic 15 amino acid peptide from internal region of human CXADR. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bat, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Zebra finch, Platypus, Lizard (93%); Xenopus, Stickleback, Pufferfish, Zebrafish (80%). |
Anti-CASP9 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 139-389 amino acids of Human Caspase-9 |
Anti-CASP9 (active) Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 41-56 amino acids of human caspase 9, apoptosis-related cysteine peptidase |
Anti-ITGAL Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 1158-1170 amino acids of Human integrin, alpha L (antigen CD11A (p180), lymphocyte function-associated antigen 1; alpha polypeptide) |
Anti-CCND1 Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-270 amino acids of Human Cyclin D1 |
Anti-CASP3 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from 1-269 amino acids of human caspase 3, apoptosis-related cysteine peptidase |
Anti-BID Rabbit Polyclonal Antibody
| Applications | ELISA, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Full length fusion protein |
Anti-ABL2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2-14 amino acids of human v-abl Abelson murine leukemia viral oncogene homolog 2 |
Active filters
Reactivities
- Human
Applications
- IHC
Families
- Druggable Genome
Pathways
- Viral myocarditis