Antibodies

View as table Download

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Rabbit Monoclonal Antibody against CASP3 (Clone E87)

Applications FC, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-BDNF Antibody

Applications IHC, WB
Reactivities Human, Macaque, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BDNF antibody: synthetic peptide directed towards the middle region of human BDNF. Synthetic peptide located within the following region: EWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEG

Rabbit anti-PRKCA Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen C term -peptide of human PRKCA

CASP3 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human CASP3

Goat Polyclonal Anti-BDNF Antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat (Expected from sequence similarity: Dog)
Conjugation Unconjugated
Immunogen The immunogen for Anti-BDNF Antibody: Peptide with sequence ETKCNPMGYTKE, from the internal region of the protein sequence according to NP_001700.2; NP_001700.2; NP_733928.1; NP_733929.1; NP_733930.1; NP_733931.1.

Rabbit polyclonal Akt (Ser473) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt
Modifications Phospho-specific

Rabbit anti-BDNF Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human BDNF

Rabbit Polyclonal Anti-JUN Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human JUN

Rabbit polyclonal Caspase 3 (Cleaved-Asp175) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Caspase 3.

Anti-Human EGF Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived recombinant Human EGF

Rabbit Polyclonal c-jun Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.

Rabbit Monoclonal Antibody against CASP3 (Clone E83-103)

Applications FC, IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Rabbit polyclonal Akt(Thr308) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Akt around the phosphorylation site of Threonine 308 (M-K-TP-F-C).
Modifications Phospho-specific

Rabbit anti-PDGFRB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PDGFRB

Rabbit Polyclonal Akt1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Akt1 antibody was raised against a 16 amino acid peptide from near the amino-terminus of human Akt1.

Rabbit polyclonal anti-PDGFR a antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PDGFR a.

Rabbit polyclonal p44/42 MAPK antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human ERK1/2.

Rabbit anti-AKT1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human AKT1

Rabbit Polyclonal AKT2 Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal PDGFR beta (Ab-1021) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I).

Rabbit polyclonal Akt (Ab-129) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A).

Rabbit polyclonal Akt (Ab-326) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R).

Rabbit polyclonal anti-TGF Beta1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human TGF β1 antibody.

Rabbit polyclonal JUN Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This JUN antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 222-251 amino acids from the C-terminal region of human JUN.

Rabbit polyclonal c-Jun (Phospho-Ser63) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of Serine 63.
Modifications Phospho-specific

Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A).

Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)

Applications IF, IHC, WB
Reactivities Human: Thr693, Mouse: Thr695, Rat: Thr694
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S).
Modifications Phospho-specific

Rabbit polyclonal Akt (Thr450) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AKT1 around the phosphorylation site of threonine 450 (T-I-TP-P-P).
Modifications Phospho-specific

Rabbit polyclonal Akt(Ab-473) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of Serine 473.

Rabbit polyclonal anti-FAS antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human Fas.

Rabbit polyclonal anti-FGF18 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human FGF18.

Rabbit polyclonal Phospho-cJun(S63) Antibody

Applications Dot, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun.
Modifications Phospho-specific

Rabbit polyclonal AKT2 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 416-444 amino acids from the C-terminal region of human AKT2.

Rabbit polyclonal PDGFRB Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This PDGFRB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-72 amino acids from the N-terminal region of human PDGFRB.

Rabbit polyclonal c-Jun (Phospho-Ser243) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human c-Jun around the phosphorylation site of serine 243 (P-L-SP-P-I).
Modifications Phospho-specific

Rabbit polyclonal c-Jun (Ab-170) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human c-Jun around the phosphorylation site of Tyrosine 170.

Rabbit anti-TGFB1 polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen peptide coupled to KLH

Rabbit polyclonal Caspase 3 (cleaved-Asp175) antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Caspase 3.

Rabbit polyclonal AKT1/2/3 (Tyr315/316/312) antibody(Phospho-specific)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A).
Modifications Phospho-specific

Rabbit polyclonal anti-EGFR antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR.

Rabbit polyclonal AKT pS473 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to the C-terminus aa 460-480 of human, mouse, rat and chicken AKT proteins conjugated to KLH.

Rabbit polyclonal anti-AKT antibody

Applications IF, IHC, WB
Reactivities Chicken, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen AKT Antibody was produced from whole rabbit serum prepared by repeated immunizations with a synthetic peptide C-R-P-H-F-P-Q-F-S-Y-S-A-S-G-T-A corresponding to the C-terminus (460-480) of human, rat and mouse and chicken AKT proteins conjugated to KLH using maleimide. A residue of cysteine was added to the amino terminal end to facilitate coupling.

Anti-CASP3 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 485-499 of Human caspase 3, apoptosis-related cysteine peptidase

Anti-AKT1/AKT2/AKT3 (phospho-Tyr315/316/312) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of tyrosine 315/316/312 (P-E-Y(p)-L-A) derived from Human AKT1/AKT2/AKT3.
Modifications Phospho-specific

Anti-AKT1 (phospho-Thr450) Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around phosphorylation site of threonine 450 (T-I-T(p)-P-P) derived from Human AKT1.
Modifications Phospho-specific

Rabbit polyclonal CASP3 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 219-248 amino acids from the C-terminal region of human CASP3.

Rabbit polyclonal Phospho-cJun(S63) Antibody

Applications Dot, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This cJun Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding S63 of human cJun.
Modifications Phospho-specific

Rabbit polyclonal CASP3(Asp175) Antibody

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CASP3(Asp175) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 149-179 amino acids from human CASP3(Asp175).

Rabbit polyclonal EGFR-S1026 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026.