Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 50 of 152 results

Page 1 of 4

(reset)

beta Catenin (CTNNB1) (C-term) Rabbit Polyclonal Antibody

AP51124PU-N

USD 450.00

2 Weeks

beta Catenin (CTNNB1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human
Immunogen	KLH conjugated synthetic peptide between 653-681 amino acids from the C-terminal region of Human Catenin beta-1.

1 / 3

2 / 3

3 / 3

Previous Next

E Cadherin (CDH1) Rabbit Polyclonal Antibody

TA327491

USD 275.00

3 Weeks

Rabbit anti-CDH1 Polyclonal Antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthetic peptide of human CDH1

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: 3F4]

AM20867PU-N

USD 480.00

2 Weeks

E Cadherin (CDH1) mouse monoclonal antibody, clone 3F4, Purified

Applications	ELISA, IF, IHC, PLA, WB
Reactivities	Human

1 / 5

2 / 5

3 / 5

4 / 5

5 / 5

Previous Next

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

TA313140

USD 345.00

In Stock

Rabbit polyclonal Catenin-beta (Tyr489) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human Catenin-β around the phosphorylation site of tyrosine 489 (L-H-YP-G-L).
Modifications	Phospho-specific

1 / 3

2 / 3

3 / 3

Previous Next

LEF1 Rabbit Polyclonal Antibody

TA349379

USD 380.00

In Stock

Rabbit Polyclonal Anti-LEF1 Antibody

Applications	IHC
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein of human LEF1

1 / 2

2 / 2

Previous Next

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

AP32836PU-T

USD 240.00

2 Weeks

beta Catenin (CTNNB1) rabbit polyclonal antibody, Purified

Applications	FC, IF, IHC, IP, WB
Reactivities	Human, Mouse
Immunogen	beta-specific amino acid sequence chosen from the middle of the beta Catenin (p120) protein.

1 / 3

2 / 3

3 / 3

Previous Next

ERK1 (MAPK3) Rabbit Polyclonal Antibody

TA326229

USD 345.00

In Stock

Rabbit polyclonal p44/42 MAPK antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from human ERK1/2.

1 / 3

2 / 3

3 / 3

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: EM-22]

AM26027PU-N

USD 270.00

2 Weeks

beta Catenin (CTNNB1) mouse monoclonal antibody, clone EM-22, Aff - Purified

Applications	FC, IF, IHC, IP, WB
Reactivities	Hamster, Human, Mouse

1 / 3

2 / 3

3 / 3

Previous Next

E Cadherin (CDH1) Rabbit Polyclonal Antibody

AP20195PU-N

USD 407.00

2 Weeks

E Cadherin (CDH1) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide, corresponding to amino acids 840-880 of Human E-cadherin.

1 / 2

2 / 2

Previous Next

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

AP32836PU-S

USD 430.00

2 Weeks

beta Catenin (CTNNB1) rabbit polyclonal antibody, Purified

Applications	FC, IF, IHC, IP, WB
Reactivities	Human, Mouse
Immunogen	beta-specific amino acid sequence chosen from the middle of the beta Catenin (p120) protein.

1 / 3

2 / 3

3 / 3

Previous Next

E Cadherin (CDH1) (N-term) Rabbit Polyclonal Antibody

AP31616PU-N

USD 440.00

2 Weeks

E Cadherin (CDH1) (N-term) rabbit polyclonal antibody, Purified

Applications	ELISA, IF, IHC, WB
Reactivities	Human
Immunogen	Synthetic peptide from Human E-cadherin.

1 / 3

2 / 3

3 / 3

Previous Next

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

TA313136

USD 345.00

In Stock

Rabbit polyclonal Catenin-beta1 antibody

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized peptide derived from internal of human Catenin-β1.

1 / 2

2 / 2

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: IMD-110]

AM20692PU-N

USD 405.00

2 Weeks

beta Catenin (CTNNB1) mouse monoclonal antibody, clone IMD-110, Purified

Applications	IF, IHC, WB
Reactivities	Chicken, Human, Rat

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

AP20705PU-N

USD 407.00

2 Weeks

beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

beta Catenin (CTNNB1) pSer37 Rabbit Polyclonal Antibody

AP20827PU-N

USD 370.00

2 Weeks

beta Catenin (CTNNB1) pSer37 rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC, WB
Reactivities	Human, Mouse, Rat

1 / 2

2 / 2

Previous Next

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

TA319264

USD 530.00

5 Days

Rabbit polyclonal beta Catenin antibody

Applications	IHC, WB
Reactivities	Bovine, Human, Mouse, Rat, Xenopus, Zebrafish
Conjugation	Unconjugated
Immunogen	beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus.

1 / 2

2 / 2

Previous Next

ERK1 (MAPK3) Rabbit Polyclonal Antibody

TA324941

USD 450.00

5 Days

Rabbit polyclonal MAPK3 Antibody (N-term)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated
Immunogen	This MAPK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human MAPK3.

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

LEF1 Rabbit Polyclonal Antibody

TA330286

USD 310.00

5 Days

Rabbit Polyclonal Anti-LEF1 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ

1 / 2

2 / 2

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: 12F7]

TA336809

USD 424.00

5 Days

Mouse Monoclonal beta-Catenin Antibody (12F7)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat, Chicken, Primate
Conjugation	Unconjugated

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

AP20706PU-N

USD 407.00

2 Weeks

beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

1 / 2

2 / 2

Previous Next

beta Catenin (CTNNB1) pSer33 Rabbit Polyclonal Antibody

AP20826PU-N

USD 370.00

2 Weeks

beta Catenin (CTNNB1) pSer33 rabbit polyclonal antibody, Aff - Purified

Applications	IF, IHC
Reactivities	Human, Mouse, Rat

1 / 2

2 / 2

Previous Next

ERK1 (MAPK3) pThr202/pTyr204 Rabbit Polyclonal Antibody

AP20886PU-N

USD 370.00

2 Weeks

ERK1 (MAPK3) pThr202/pTyr204 rabbit polyclonal antibody, Aff - Purified

Applications	IHC, WB
Reactivities	Human, Mouse, Rat

1 / 2

2 / 2

Previous Next

TCF7 (617-631) Goat Polyclonal Antibody

AP23981PU-N

USD 440.00

2 Weeks

TCF7 (617-631) goat polyclonal antibody, Aff - Purified

Applications	IHC
Reactivities	Bat, Canine, Equine, Hamster, Human, Mouse, Porcine, Rat
Immunogen	Synthetic peptide from positions 617-631 of human TCF1 (NP_000536.5)

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

TA313142

USD 345.00

4 Weeks

Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A).
Modifications	Phospho-specific

1 / 2

2 / 2

Previous Next

E Cadherin (CDH1) Rabbit Polyclonal Antibody

TA325337

USD 345.00

4 Weeks

Rabbit Polyclonal E-cadherin Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	A synthesized peptide derived from human E-cadherin

1 / 2

2 / 2

Previous Next

TCF7 Rabbit Polyclonal Antibody

TA338240

USD 375.00

5 Days

Rabbit Polyclonal Anti-TCF7 Antibody

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated
Immunogen	The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM

1 / 2

2 / 2

Previous Next

beta Catenin (CTNNB1) pSer33/37/pThr41 Rabbit Polyclonal Antibody

AP20926PU-N

USD 370.00

2 Weeks

beta Catenin (CTNNB1) pSer33/37/pThr41 rabbit polyclonal antibody, Aff - Purified

Applications	IHC
Reactivities	Human, Mouse, Rat

beta Catenin (CTNNB1) pThr41/pSer45 Rabbit Polyclonal Antibody

AP20927PU-N

USD 370.00

2 Weeks

beta Catenin (CTNNB1) pThr41/pSer45 rabbit polyclonal antibody, Aff - Purified

Applications	IHC
Reactivities	Human, Mouse, Rat

beta Catenin (CTNNB1) Rabbit Polyclonal Antibody

AP21016PU-N

USD 370.00

2 Weeks

beta Catenin (CTNNB1) rabbit polyclonal antibody, Aff - Purified

Applications	IHC
Reactivities	Human, Mouse, Rat

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI1F3]

CF500048

USD 465.00

3 Weeks

Carrier-free (BSA/glycerol-free) Beta-catenin mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications	IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 3

2 / 3

3 / 3

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI1G1]

CF502299

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 4

2 / 4

3 / 4

4 / 4

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI1H10]

CF502300

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI1E10]

CF502304

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1E10 (formerly 1E10)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI6A3]

CF502337

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI6A3 (formerly 6A3)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI1B11]

CF502340

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)

Applications	FC, IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 16

2 / 16

3 / 16

4 / 16

5 / 16

6 / 16

7 / 16

8 / 16

9 / 16

10 / 16

11 / 16

12 / 16

13 / 16

14 / 16

15 / 16

16 / 16

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI9H2]

CF502341

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI9H2 (formerly 9H2)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 6

2 / 6

3 / 6

4 / 6

5 / 6

6 / 6

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI3F9]

CF502407

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI3F9 (formerly 3F9)

Applications	FC, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI9C1]

CF502408

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI9C1 (formerly 9C1)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI12H7]

CF502409

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI12H7 (formerly 12H7)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 14

2 / 14

3 / 14

4 / 14

5 / 14

6 / 14

7 / 14

8 / 14

9 / 14

10 / 14

11 / 14

12 / 14

13 / 14

14 / 14

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI9F6]

CF502412

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI9F6 (formerly 9F6)

Applications	FC, IF, IHC, WB
Reactivities	Human, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

ERK1 (MAPK3) Mouse Monoclonal Antibody [Clone ID: OTI4D7]

CF505700

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) MAPK3 mouse monoclonal antibody, clone OTI4D7 (formerly 4D7)

Applications	IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: OTI2D6]

CF800669

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody, clone OTI2D6 (formerly 2D6)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 11

2 / 11

3 / 11

4 / 11

5 / 11

6 / 11

7 / 11

8 / 11

9 / 11

10 / 11

11 / 11

Previous Next

E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: OTI3E2]

CF800670

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: OTI1F3]

CF800671

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody, clone OTI1F3 (formerly 1F3)

Applications	IHC, WB
Reactivities	Human, Dog
Conjugation	Unconjugated

• 

1 / 7

2 / 7

3 / 7

4 / 7

5 / 7

6 / 7

7 / 7

Previous Next

E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: OTI2F9]

CF800691

USD 465.00

3 Weeks

Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody, clone OTI2F9 (formerly 2F9)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: OTI4F1]

CF800692

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody,clone OTI4F1

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: OTI1G1]

CF800696

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody,clone OTI1G1

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: OTI1B11]

CF800718

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody,clone OTI1B11

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 13

2 / 13

3 / 13

4 / 13

5 / 13

6 / 13

7 / 13

8 / 13

9 / 13

10 / 13

11 / 13

12 / 13

13 / 13

Previous Next

E Cadherin (CDH1) Mouse Monoclonal Antibody [Clone ID: OTI3C11]

CF803253

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) CDH1 mouse monoclonal antibody, clone OTI3C11 (formerly 3C11)

Applications	IHC, WB
Reactivities	Human
Conjugation	Unconjugated

• 

1 / 12

2 / 12

3 / 12

4 / 12

5 / 12

6 / 12

7 / 12

8 / 12

9 / 12

10 / 12

11 / 12

12 / 12

Previous Next

beta Catenin (CTNNB1) Mouse Monoclonal Antibody [Clone ID: OTI2F10]

CF807908

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications	IHC, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated

• 

1 / 8

2 / 8

3 / 8

4 / 8

5 / 8

6 / 8

7 / 8

8 / 8

Previous Next

1 - 50 of 152 results

Page 1 of 4