Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal EGFR (Ab-1172) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q). |
Rabbit polyclonal CaMKII (Thr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMKII around the phosphorylation site of threonine 305 (I-L-TP-T-M). |
| Modifications | Phospho-specific |
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit polyclonal PKA alpha/beta CAT (Thr197) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKA a/β CAT around the phosphorylation site of threonine 197 (T-W-TP-L-C). |
| Modifications | Phospho-specific |
Mouse Monoclonal anti-CAMK2A Antibody
| Applications | IHC |
| Reactivities | Bovine, Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit polyclonal HER2 (Tyr877) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HER2 around the phosphorylation site of Tyrosine 877 (T-E-YP-H-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E). |
| Modifications | Phospho-specific |
Anti-PTK2B (Phospho-Tyr402) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 402 (D-I-Y(p)-A-E) derived from Human Pyk2. |
| Modifications | Phospho-specific |
Anti-ERBB3 (phospho-Tyr1328) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 1328 (P-D-Y(p)-W-H) derived from Human Her3/ErbB3. |
| Modifications | Phospho-specific |
Rabbit polyclonal ERBB2 Antibody(N-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ERBB2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 21-52 amino acids from the N-terminal region of human ERBB2. |
Rabbit polyclonal PDGFRB Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PDGFRB antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 40-72 amino acids from the N-terminal region of human PDGFRB. |
EGFR L858R mouse monoclonal antibody,clone UMAB233
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit polyclonal HER2 (Tyr1248) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | HER2 (phospho-Tyr1248) antibody detects endogenous levels of HER2 only when phosphorylated at tyrosine 1248. |
| Modifications | Phospho-specific |
Rabbit polyclonal PYK2 (Tyr579) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PYK2 around the phosphorylation site of tyrosine 579 (E-D-YP-Y-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKA CAT (Ab-197) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PKA CAT around the phosphorylation site of threonine197 (T-W-TP-L-C). |
Rabbit polyclonal anti-EGFR antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a peptide synthesized using conventional technology. The sequence of the epitope maps to a region near the carboxy terminus which is identical in human, mouse and rat EGFR. |
Rabbit polyclonal Phospho-HER4(Y1162) Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This HER4 Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y1162 of human HER4. |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR-S1026 Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EGFR-S1026 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1004-1033 amino acids from the C-terminal region of human EGFR-S1026. |
Rabbit Polyclonal Antibody against PRKCB1 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This PKC beta2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-673 amino acids from the C-terminal region of human PKC beta2. |
Rabbit polyclonal EGFR phospho Y1197 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1189-1199 of human EGFR protein. |
Rabbit polyclonal EGFR (ErbB1) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This EGFR (ErbB1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 27-57 amino acids from the N-terminal region of human EGFR (ErbB1). |
Rabbit Polyclonal Anti-PHKG2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PHKG2 Antibody: synthetic peptide directed towards the N terminal of human PHKG2. Synthetic peptide located within the following region: EDELPDWAAAKEFYQKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEV |
Rabbit Polyclonal Anti-PDGFRB Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | PDGFRB / PDGFR Beta antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human PDGFRB. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Rabbit, Pig (100%); Mouse, Rat, Elephant, Horse (93%); Dog, Hamster, Panda (86%). |
Rabbit polyclonal CaMK2 alpha/beta/delta antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human CaMK2a/β/d. |
Rabbit Polyclonal Anti-ERBB4 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ERBB4 / HER4 antibody was raised against synthetic 20 amino acid peptide from internal region of human ERBB4. Percent identity with other species by BLAST analysis: Human, Gibbon, Marmoset, Mouse, Rat, Panda, Dog, Bat, Horse, Pig, Opossum, Turkey, Chicken, Platypus (100%). |
Rabbit Polyclonal Anti-ERBB2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ERBB2 / HER2 antibody was raised against synthetic 13 amino acid peptide from N-terminal extracellular domain of human ERBB2 / HER2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Bovine, Dog, Horse (100%); Bat, Elephant, Pig (92%); Panda, Opossum (85%). |
Rabbit anti CaM Kinase IV Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide from aa 457-474 of rat CaM Kinase IV. |
Active filters
Reactivities
- Human
Applications
- IHC
Families
- Protein Kinase
Pathways
- Calcium signaling pathway