Antibodies

Jump to Filters
View as table Download
TNF alpha (TNF) Rabbit Polyclonal Antibody
AP20373PU-N

USD 370.00

In Stock

TNF alpha (TNF) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to amino acids 141-190 of Human TNF-α.
TNFRSF1A Rabbit Polyclonal Antibody
TA327070

USD 275.00

3 Weeks

Rabbit anti-TNF-R1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Mouse, Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TNF-R1
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA313322

USD 345.00

In Stock

Rabbit polyclonal anti-TNFA antibody

Applications IF, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human TNFA.
TNFRSF1A (N-term) Rabbit Polyclonal Antibody
AP54311PU-N

USD 450.00

2 Weeks

TNFRSF1A (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IF, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 24-52 amino acids from the N-terminal region of human TNFRSF1A
TNFRSF1A (195-211) Rabbit Polyclonal Antibody
AP23346PU-N

USD 405.00

2 Weeks

TNFRSF1A (195-211) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Goat, Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequencein the middle region of Human TNFR1 (aa 195-211).
TNFRSF1A (20-43) Rabbit Polyclonal Antibody
AP33393PU-N

USD 440.00

2 Weeks

TNFRSF1A (20-43) rabbit polyclonal antibody, Purified

Applications IHC, IP, WB
Reactivities Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat
Immunogen TNFRSF1A antibody was raised against a synthetic peptide based on residues 20-43 of Mouse TNF-R1.
TNFRSF1A Rabbit Polyclonal Antibody
TA311833

USD 345.00

In Stock

Rabbit polyclonal TNF Receptor-1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TNF receptor-1.
TNF alpha (TNF) Goat Polyclonal Antibody
TA328454

USD 285.00

5 Days

Anti-Human TNF-a Goat Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α
TNFRSF1B (N-term) Rabbit Polyclonal Antibody
AP23408PU-N

USD 405.00

2 Weeks

TNFRSF1B (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human TNFR2/TNFRSF1B.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319289

USD 1,380.00

5 Days

Rabbit polyclonal TNF Alpha antibody

Applications IHC, WB
Reactivities Human, Primate
Conjugation Unconjugated
Immunogen The whole rabbit serum was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA319290

USD 1,380.00

5 Days

Rabbit polyclonal TNF alpha antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The whole rabbit serum used to produce this IgG fraction antibody was prepared by repeated immunizations with recombinant human TNFa produced in E.coli.
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA328455

USD 285.00

5 Days

Anti-Human TNF-a Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TNF-α
TNFRSF1A Rabbit Polyclonal Antibody
TA330321

USD 375.00

5 Days

Rabbit Polyclonal Anti-TNFRSF1A Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF1A antibody: synthetic peptide directed towards the N terminal of human TNFRSF1A. Synthetic peptide located within the following region: MGLSTVPDLLLPLVLLELLVGIYPSGVIGLVPHLGDREKRDSVCPQGKYI
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA336738

USD 479.00

5 Days

Rabbit Polyclonal TNF-alpha Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human TNF alpha protein (between residues 100-200) [UniProt P01375]
TNFRSF1B (C-term) Rabbit Polyclonal Antibody
AP31209PU-N

USD 440.00

2 Weeks

TNFRSF1B (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide derived from C-terminal of Mouse TNF-R2
TNFRSF1B Rabbit Polyclonal Antibody
TA328459

USD 285.00

5 Days

Anti-Human sTNF Receptor Type II Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human sTNF Receptor Type II
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1D9]
CF506510

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5H8]
CF807833

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
TNFRSF1B Rabbit Polyclonal Antibody
TA321269

USD 345.00

4 Weeks

Anti-TNFRSF1B Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 291-461 amino acids of human tumor necrosis factor receptor superfamily, member 1B
TNF alpha (TNF) Rabbit Polyclonal Antibody
TA323618

USD 345.00

In Stock

Anti-TNF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 57-233 amino acids of human tumor necrosis factor
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1D9]
TA506510

USD 379.00

In Stock

TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI1D9]
TA506510S

USD 159.00

2 Days

TNF mouse monoclonal antibody, clone OTI1D9 (formerly 1D9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".

TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5H8]
TA807833

USD 379.00

In Stock

TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
TNF alpha (TNF) Mouse Monoclonal Antibody [Clone ID: OTI5H8]
TA807833S

USD 159.00

In Stock

TNF mouse monoclonal antibody, clone OTI5H8 (formerly 5H8)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

Special Offer: Get this product for $99/€99. Use code: "Truesample".