Germany
Japan
United Kingdom
China
Antibodies
View as table Download
USD 380.00
In Stock
MCP-2 / CCL8 Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
Rabbit polyclonal IL8 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IL8 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 72-99 amino acids from the C-terminal region of human IL8. |
CCL5 / RANTES Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
SDF1 (CXCL12) (beta) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, FN, IHC, WB |
| Reactivities | Human |
| Immunogen | E. Coli derived Recombinant recombinant Human SDF-1 beta |
Rabbit polyclonal CCL2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CCL2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 62-89 amino acids from the C-terminal region of human CCL2. |
USD 285.00
5 Days
PF4 sheep polyclonal antibody, Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | PF4 antibody was raised against platelet Factor 4 (PF4) purified from human platelet releasate. |
USD 425.00
2 Weeks
Anti-CCL20 Mouse Monoclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 440.00
2 Weeks
Macrophage Inflammatory Protein 3 alpha (CCL20) (33-44) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Human |
| Immunogen | Peptide with sequence from the internal region of Human CCL20 (NP_004582.1; NP_001123518.1) |
USD 375.00
5 Days
Macrophage Inflammatory Protein 3 alpha (CCL20) goat polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC |
| Reactivities | Bovine, Human, Porcine |
| Immunogen | Peptide with sequence from the internal region of Human CCL20 (NP_004582.1; NP_001123518.1). Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (92%). |
Rabbit Polyclonal Anti-CCL18 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CCL18 antibody: synthetic peptide directed towards the middle region of human CCL18. Synthetic peptide located within the following region: PQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
CCL3 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
Anti-Human Eotaxin Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human Eotaxin (CCL11) |
Active filters
Applications
- IHC
Families
- Secreted Protein
Pathways
- Chemokine signaling pathway
Filter by
Category
Target Symbol
- CCL19 (10)
- CXCL12 (9)
- CCL2 (6)
- CCL20 (4)
- CCL1 (3)
- CCL17 (3)
- CCL21 (3)
- CCL5 (3)
- CX3CL1 (3)
- CXCL8 (3)
- CCL15 (2)
- CCL4 (2)
- CCL7 (2)
- CXCL14 (2)
- CXCL3 (2)
- CXCL5 (2)
- PF4 (2)
- CCL11 (1)
- CCL13 (1)
- CCL14 (1)
- CCL16 (1)
- CCL18 (1)
- CCL23 (1)
- CCL25 (1)
- CCL26 (1)
- CCL28 (1)
- CCL3 (1)
- CCL8 (1)
- CXCL1 (1)
- CXCL10 (1)
- CXCL11 (1)
- CXCL16 (1)
- CXCL2 (1)
- CXCL9 (1)
- PF4V1 (1)
- XCL1 (1)