Antibodies

View as table Download

ABCC4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ABCC4

Mouse Monoclonal ABCG2/CD338 Antibody (3G8)

Applications ELISA, FC, IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated

Goat Polyclonal Antibody against ABCC4

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence CNGQPSTLTIFETAL, from the C Terminus of the protein sequence according to NP_005836.2.

Rabbit Polyclonal Anti-CFTR Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen CFTR antibody was raised against an 18 amino acid peptide near the carboxy terminus of human CFTR.

TAP2 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TAP2

Rabbit Polyclonal Anti-CFTR

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KEETEEEVQDTRL, corresponding to amino acid residues 1468-1480 of human CFTR . Cytoplasmic, C-terminal part.

Mouse Anti-ABCA4 (Rim Protein) Antibody

Applications IHC
Reactivities Bovine, Human, Mouse, Xenopus
Conjugation Unconjugated

Mouse Monoclonal ABCA1 Antibody (HJ1) - Astrocyte Marker

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ABCA1 (1800-2260) mouse monoclonal antibody, clone AB1.G6, Aff - Purified

Applications ELISA, IHC, IP, WB
Reactivities Human

ABCG1 rabbit polyclonal antibody, Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 366~395 from the Center region of Human ABCG1

P Glycoprotein (ABCB1) mouse monoclonal antibody, clone PG-13, Purified

Applications IF, IHC, WB
Reactivities Human

ABCB5 (N-term) rabbit polyclonal antibody, Ig Fraction

Applications FC, IHC, WB
Reactivities Human
Immunogen ABCB5 antibody was raised against kLH conjugated synthetic peptide selected from the N-terminal region of human ABCB5.

MRP3 (ABCC3) (Center) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 906-933 amino acids from the Central region of human ABCC3.

Rabbit Polyclonal ABCB5 Antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human ABCB5 protein (between residues 450-500) [UniProt Q2M3G0]

Rabbit polyclonal anti-ABCB7 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ABCB7.

Anti-ABCG1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 349-362 amino acids of human ATP-binding cassette, sub-family G (WHITE), member 1

Rabbit Polyclonal Anti-TAP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAP1 Antibody: synthetic peptide directed towards the middle region of human TAP1. Synthetic peptide located within the following region: LVTFVLYQMQFTQAVEVLLSIYPRVQKAVGSSEKIFEYLDRTPRCPPSGL

Rabbit Polyclonal Anti-ABCC8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCC8 Antibody: synthetic peptide directed towards the N terminal of human ABCC8. Synthetic peptide located within the following region: PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGW

Rabbit Polyclonal ABCG1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Hamster
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal region of human ABCG1 (between residues 300-400). [UniProt# P45844]

Mouse Monoclonal ABCG5 Antibody (1B5E10)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

ABCG2 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

ABCB5 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen Synthetic peptide

ABCC10 (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 767-793 amino acids from the Central region of human ABCC10

Goat Anti-ABCD4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RDDIDNPDQRISQD, from the internal region of the protein sequence according to NP_005041.1.

Goat Anti-ABCA9 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRVVQELEMENIQD, from the internal region of the protein sequence according to NP_525022.2.

Goat Anti-MRP8 / ABCC11 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KVVEFDRPEVLRK, from the internal region (near C Terminus) of the protein sequence according to NP_115972.2; NP_660187.1.

TAP2 Rabbit Polyclonal (aa689-703) Antibody

Applications IHC
Reactivities Human
Immunogen TAP2 antibody was raised against synthetic peptide from human TAP2.

Anti-ABCC5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 2-14 amino acids of Human ATP-binding cassette, sub-family C?

Rabbit Polyclonal Anti-ABCA5 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ABCA5 Antibody: synthetic peptide directed towards the C terminal of human ABCA5. Synthetic peptide located within the following region: HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI

P Glycoprotein (ABCB1) rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

Goat Anti-ABCB9 / TAPL Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GHNEPVANGSHKA, from the C Terminus of the protein sequence according to NP_062570.1; NP_062571.1; NP_982269.1.

Rabbit Polyclonal Anti-ABCB1 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Immunogen ABCB1 / MDR1 / P Glycoprotein antibody was raised against synthetic 15 amino acid peptide from cytoplasmic domain of human ABCB1 / MDR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset (100%); Monkey (93%); Mouse, Rat, Hamster, Cat, Dog, Pig (80%).

Rabbit Polyclonal Anti-ABCB1 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen ABCB1 / MDR1 / P Glycoprotein antibody was raised against synthetic 17 amino acid peptide from cytoplasmic domain of human ABCB1 / MDR1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon (100%); Monkey (94%); Mouse, Hamster (82%).

Carrier-free (glycerol/BSA-free) Purified ABCB1 mouse monoclonal antibody, clone OTI3C8 (formerly 3C8)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2C7 (formerly 2C7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI6H2 (formerly 6H2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2G6 (formerly 2G6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI2G1 (formerly 2G1)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI3B2 (formerly 3B2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI5B3 (formerly 5B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI8A9 (formerly 8A9)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI11D2 (formerly 11D2)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI1A7 (formerly 1A7)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI10H3 (formerly 10H3)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCC5 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody, clone OTI6E4 (formerly 6E4)

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody,clone OTI16D9

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody,clone OTI2H2

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCB1 mouse monoclonal antibody,clone OTI9C10

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ABCC2 mouse monoclonal antibody,clone OTI5C3

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated