Germany
Japan
United Kingdom
China
Rabbit anti-PDGFRB Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PDGFRB |
Antibodies
Download
Rabbit Polyclonal Anti-SRD5A2 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Monkey |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SRD5A2 antibody: synthetic peptide directed towards the N terminal of human SRD5A2. Synthetic peptide located within the following region: MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLKPAATRLPAR |
Rabbit Polyclonal Antibody against PIK3R1 (N-term L11)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PI3KR1. |
Rabbit Polyclonal Antibody against AKT2 (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 93-123 amino acids from the N-terminal region of human AKT2. |
Anti-Human IGF-I Rabbit Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human IGF-I |
Rabbit anti-AKT1 Polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human AKT1 |
Rabbit Polyclonal Antibody against MDM2 (C-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This Mdm2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 393-424 amino acids from the C-terminal region of human Mdm2. |
Rabbit Polyclonal Antibody against FRAP1 (S2481)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This mTOR (FRAP1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 2459-2488 amino acids from human mTOR (FRAP1). |
Rabbit anti-BAD (Phospho-Ser136) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from mouse BAD around the phosphorylation site of serine136 (S-R-S[P]-A-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal Cyclin E1 (Ab-395) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P). |
Rabbit polyclonal PDGFR beta (Ab-1021) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human PDGFR β around the phosphorylation site of tyrosine 1021 (N-D-YP-I-I). |
Rabbit polyclonal HSP90B (Ab-254) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human HSP90B around the phosphorylation site of serine 254 (V-G-SP-D-E). |
Rabbit polyclonal Raf1 (Ab-621) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RAF1 around the phosphorylation site of serine 621 (S-A-S-E-P). |
Rabbit polyclonal Akt (Ab-129) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of serine 129 (D-N-SP-G-A). |
Rabbit polyclonal Akt (Ab-326) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Akt around the phosphorylation site of tyrosine 326 (N-D-YP-G-R). |
Rabbit polyclonal NFkB p65 phospho S536 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding S536 of human p65 (RelA) protein. |
Rabbit polyclonal HSP90B1 Antibody (N-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Hamster |
| Conjugation | Unconjugated |
| Immunogen | This HSP90B1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 16-43 amino acids from the N-terminal region of human HSP90B1. |
Rabbit polyclonal B-RAF (Phospho-Ser446) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D). |
| Modifications | Phospho-specific |
IKBKB Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IKBKB |
Rabbit anti-IGF1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human IGF1 |
Rabbit anti-PDPK1 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant Protein of human PDPK1 |
USD 450.00
In Stock
Rabbit Polyclonal Antibody against PIK3CG (Center)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PI3KCG antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 518-547 amino acids from the Central region of human PI3KCG. |
Rabbit Polyclonal antibody to PIK3R3 (phosphoinositide-3-kinase, regulatory subunit 3 (gamma))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 192 and 427 of PIK3R3 |
Rabbit anti-ATF4 (Phospho-Ser245) polyclonal antibody (Phospho-specific)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanATF4 around the phosphorylation site of serine 245 (N-R-SP-L-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A). |
Rabbit polyclonal IGF1R (Ab-1346) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IGF1R around the phosphorylation site of tyrosine 1346 (Q-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal Cyclin E1 (Thr395) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-TP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal IKK-alpha (Ser176)/IKK-beta (Phospho-Ser177) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IKK-a around the phosphorylation site of serine 176/177 (Q-G-SP-L-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal HER2 (Tyr877) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HER2 around the phosphorylation site of Tyrosine 877 (T-E-YP-H-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal EGFR (Thr693) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human: Thr693, Mouse: Thr695, Rat: Thr694 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human EGFR around the phosphorylation site of threonine 693 (P-L-TP-P-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal Caspase 9 (Thr125) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Caspase 9 around the phosphorylation site of threonine 125 (P-E-TP-P-R). |
| Modifications | Phospho-specific |
Rabbit polyclonal IkB-a (Tyr305) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human I?B-a around the phosphorylation site of tyrosine 305 (L-P-YP-D-D). |
| Modifications | Phospho-specific |
Rabbit polyclonal NF-kB p105/p50 (Ser893) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NF-?B p105/p50 around the phosphorylation site of serine 893. |
| Modifications | Phospho-specific |
Active filters
Reactivities
- Human
Applications
- IHC
Pathways
- Prostate cancer
Filter by
Target Symbol
- MAP2K1 (173)
- TP53 (137)
- ERBB2 (103)
- NKX3-1 (72)
- CTNNB1 (71)
- AKT1 (65)
- BCL2 (58)
- PIK3CG (54)
- MDM2 (45)
- MTOR (45)
- EGFR (39)
- KLK3 (36)
- PIK3R5 (36)
- AR (30)
- BRAF (29)
- MAPK1 (29)
- PIK3CD (28)
- HRAS (27)
- RB1 (25)
- PIK3CA (22)
- CDKN1A (21)
- FGFR2 (20)
- MAP2K2 (18)
- RELA (16)
- PDGFRA (15)
- GSTP1 (14)
- IGF1 (14)
- BAD (13)
- NFKBIA (13)
- ARAF (11)
- CASP9 (11)
- AKT2 (10)
- HSP90AB1 (10)
- IKBKG (10)
- AKT3 (9)
- CREB1 (9)
- PDGFRB (9)
- EGF (8)
- NRAS (8)
- PTEN (8)
- CHUK (7)
- FOXO1 (7)
- GSK3B (7)
- HSP90AA1 (7)
- LEF1 (7)
- MAPK3 (7)
- NFKB1 (7)
- CCNE1 (6)
- HSP90B1 (6)
- IKBKB (5)
- RAF1 (5)
- IGF1R (4)
- PDGFB (4)
- PIK3R1 (4)
- ATF4 (3)
- CCND1 (3)
- CREBBP (3)
- EP300 (3)
- FGFR1 (3)
- GRB2 (3)
- INS (3)
- PDGFA (3)
- PDPK1 (3)
- TGFA (3)
- CCNE2 (2)
- CDK2 (2)
- CDKN1B (2)
- E2F1 (2)
- PIK3R3 (2)
- CREB3L1 (1)
- CREB3L2 (1)
- CREB3L4 (1)
- E2F2 (1)
- E2F3 (1)
- PDGFC (1)
- PIK3CB (1)
- PIK3R2 (1)
- SRD5A2 (1)
- TCF7 (1)
- TCF7L1 (1)
Antibody Hosts
Isotypes
Clonalities
Conjugates
Knockout (KO) Validation
Modifications
Families
- Druggable Genome (1499)
- Protein Kinase (618)
- Transcription Factors (462)
- ES Cell Differentiation/IPS (371)
- Transmembrane (263)
- Stem cell - Pluripotency (225)
- Secreted Protein (115)
- Adult stem cells (55)
- Protease (47)
- Stem cell relevant signaling - JAK/STAT signaling pathway (42)
- Cancer stem cells (39)
- Nuclear Hormone Receptor (30)
- Embryonic stem cells (9)
- Induced pluripotent stem cells (9)
- Stem cell relevant signaling - DSL/Notch pathway (9)
- Phosphatase (8)
- Stem cell relevant signaling - Wnt Signaling pathway (3)