Antibodies

View as table Download

Rabbit polyclonal anti-BRCA2 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human BRCA2.

Rabbit anti-RPA2 Polyclonal Antibody

Applications ChIP, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human RPA2

Rabbit anti-MRE11A Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human MRE11A

Rabbit polyclonal anti-MtSSB antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MtSSB.

Rabbit anti-POLD1 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human POLD1

Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694)

Rabbit Polyclonal Anti-RAD51 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS

Rabbit Polyclonal MRE11 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen MRE11 antibody was raised against a 14 amino acid peptide from near the amino terminus human MRE11.

Rabbit polyclonal anti-RAD51L1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD51L1.

Rabbit polyclonal anti-XRCC3 antibody

Applications IF, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human XRCC3.

Rabbit polyclonal anti-XRCC3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human XRCC3.

Rabbit polyclonal Bloom Syndrome Protein (Thr99)(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Bloom Syndrome Protein around the phosphorylation site of threonine 99 (Q-E-TP-Q-R).
Modifications Phospho-specific

Rabbit Polyclonal Antibody against Mre11

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Full length human Mre11 protein

Rabbit polyclonal antibody to RPA 14 kDa subunit (replication protein A3, 14kDa)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 121 of RPA14 (Uniprot ID#P35244)

Rabbit polyclonal antibody to RPA 32 kDa subunit (replication protein A2, 32kDa)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 202 of RPA32 (Uniprot ID#P15927)

Rabbit polyclonal anti-XRCC2 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human XRCC2.

Rabbit Polyclonal NIBRIN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen NIBRIN antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human NIBRIN.

Rabbit Polyclonal NIBRIN Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen NIBRIN antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human NIBRIN.

Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S).
Modifications Phospho-specific

Rabbit Polyclonal Nbs1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the mouse NBS1 protein (within residues 350-400). [Swiss-Prot# Q9R207]

Rabbit Polyclonal Nbs1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the mouse NBS1 protein (within residues 150-200). [Swiss-Prot# Q9R207]

Rabbit Polyclonal Anti-RAD54B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the N terminal of human RAD54B. Synthetic peptide located within the following region: DAVLIVKGKSFILKNLEGKDIGRGIGYKFKELEKIEEGQTLMICGKEIEV

Rabbit Polyclonal Anti-RAD54B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RAD54B antibody: synthetic peptide directed towards the middle region of human RAD54B. Synthetic peptide located within the following region: NSLKPLSMSQLKQWKHFSGDHLNLTDPFLERITENVSFIFQNITTQATGT

Rabbit polyclonal anti-RAD54B antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human RAD54B.

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)

Applications FC, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)

Applications FC, IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7F4 (formerly 7F4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI1F11 (formerly 1F11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI2E9 (formerly 2E9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI1G10 (formerly 1G10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI3A2 (formerly 3A2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI1G1 (formerly 1G1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI3A9 (formerly 3A9)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI8E6 (formerly 8E6)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI6D10 (formerly 6D10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI2G4 (formerly 2G4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody,clone OTI8E7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI3A4 (formerly 3A4)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI5E11 (formerly 5E11)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI2E10 (formerly 2E10)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI3C12 (formerly 3C12)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI9H2 (formerly 9H2)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody,clone OTI6H7

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody, clone OTI7D5 (formerly 7D5)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NBN mouse monoclonal antibody,clone OTI6E11

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated