Rabbit anti-RPA2 Polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPA2 |
Rabbit anti-RPA2 Polyclonal Antibody
Applications | ChIP, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human RPA2 |
Rabbit anti-MRE11A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human MRE11A |
Rabbit polyclonal anti-MtSSB antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MtSSB. |
Rabbit anti-POLD1 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human POLD1 |
Rabbit Polyclonal antibody to RPA70 (replication protein A1, 70kDa)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 369 and 616 of RPA70 (Uniprot ID#P27694) |
Rabbit Polyclonal Anti-RAD51 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-RAD51 Antibody: synthetic peptide directed towards the N terminal of human RAD51. Synthetic peptide located within the following region: ANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAKADKILVMAERYGLS |
Rabbit Polyclonal MRE11 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | MRE11 antibody was raised against a 14 amino acid peptide from near the amino terminus human MRE11. |
Rabbit polyclonal anti-RAD51L1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human RAD51L1. |
Rabbit Polyclonal Antibody against Mre11
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Full length human Mre11 protein |
Rabbit Polyclonal NIBRIN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | NIBRIN antibody was raised against a 15 amino acid synthetic peptide near the carboxy terminus of human NIBRIN. |
Rabbit Polyclonal NIBRIN Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | NIBRIN antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human NIBRIN. |
Rabbit polyclonal RFA2 (Thr21) antibody(Phospho-specific)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RFA2 around the phosphorylation site of threonine 21 (G-Y-TP-Q-S). |
Modifications | Phospho-specific |
Rabbit Polyclonal Nbs1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the mouse NBS1 protein (within residues 350-400). [Swiss-Prot# Q9R207] |
Rabbit Polyclonal Nbs1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide made to an internal portion of the mouse NBS1 protein (within residues 150-200). [Swiss-Prot# Q9R207] |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI8B3 (formerly 8B3)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RPA2 mouse monoclonal antibody, clone OTI7F4 (formerly 7F4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-RAD50 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 325-339 amino acids of Human RAD50 homolog (S. cerevisiae) |
Anti-RAD52 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 360-375 amino acids of Human RAD52 homolog (S. cerevisiae) |
Anti-RAD52 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 361-374 amino acids of Human RAD52 homolog (S. cerevisiae) |
Anti-RAD51 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 301-312 amino acids of Human RAD51 homolog (S. cerevisiae) |
Anti-NBN Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 729-743 amino acids of human nibrin |
Anti-NBN Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 729-743 amino acids of human nibrin |
Anti-BRCA2 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 110-124 amino acids of Human Breast cancer type 2 susceptibility protein |
Rabbit Polyclonal Anti-MRE11A Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MRE11A |
Rabbit Polyclonal Anti-SSBP1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human SSBP1 |
Rabbit Polyclonal Anti-RAD51 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human RAD51 |
RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1), Biotinylated
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1), HRP conjugated
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPA2 mouse monoclonal antibody, clone OTI10G1 (formerly 10G1)
Applications | FC, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | HRP |
RPA2 mouse monoclonal antibody, clone OTI9A1 (formerly 9A1)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
RPA2 mouse monoclonal antibody, clone OTI3A12 (formerly 3A12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
RPA2 mouse monoclonal antibody, clone OTI1H10 (formerly 1H10)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12)
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12), Biotinylated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
USD 420.00
4 Weeks
RPA2 mouse monoclonal antibody, clone OTI7C12 (formerly 7C12), HRP conjugated
Applications | FC, IF, IHC, IP, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |