Germany
Japan
United Kingdom
China
Antibodies
View as table Download
c-Myc (MYC) chicken polyclonal antibody, Aff - Purified
| Applications | ELISA, IF, IHC, IP, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide containing the Human c-myc epitope (i.e., EQKLISEEDL) conjugated to KLH. The first injection included complete Freund's adjuvant; subsequent injections included incomplete Freund's adjuvant. Eggs were collected after the fourth injection, and antibodies were purified from the yolks using a proprietary method that yields a purity of >90%. |
HDAC2 Rabbit Polyclonal Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human HDAC2 |
Hsp60 (HSPD1) goat polyclonal antibody, Purified
| Applications | IHC, IP, WB |
| Reactivities | Bacteria, Bovine, Canine, Drosophila, Fish, Guinea Pig, Hamster, Human, Monkey, Mouse, Porcine, Rabbit, Rat, Sheep, Xenopus |
| Immunogen | HSPD1 antibody was raised against recombinant human HSP60. |
Rabbit polyclonal antibody to Ku80 (XRCC5) (X-ray repair complementing defective repair in Chinese hamster cells 5 (double-strand-break rejoining))
| Applications | IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 315 and 593 of Ku80 (Uniprot ID#P13010) |
MCM3 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MCM3 |
KPNA2 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human KPNA2 |
MNAT1 Rabbit Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MNAT1 |
Rabbit anti-LSM4 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LSM4 |
Rabbit anti-SMARCC1 Polyclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human SMARCC1 |
Rabbit polyclonal Anti-SET Antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SET antibody: synthetic peptide directed towards the N terminal of human SET. Synthetic peptide located within the following region: IDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVT |
Rabbit Polyclonal anti-HSPA9 antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HSPA9 antibody: synthetic peptide directed towards the C terminal of human HSPA9. Synthetic peptide located within the following region: GENIRQAASSLQQASLKLFEMAYKKMASEREGSGSSGTGEQKEDQKEEKQ |
Rabbit polyclonal anti-Mre11 antibody
| Applications | IP |
| Reactivities | Saccharomyces cerevisiae |
| Conjugation | Unconjugated |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 578-590 of Saccharomyces cerevisiae (baker's yeast) Mre11 protein. |
Rabbit Polyclonal Ku80/XRCC5 Antibody
| Applications | IP |
| Reactivities | Hamster, Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to residues 323-338 [FSKVDEEQMKYKSEGK] of the 80 kDa Ku80 protein. |
Active filters
Applications
- IP
Clonalities
- Polyclonal
Families
- Stem cell - Pluripotency
Filter by
Category
Target Symbol
Reactivities
Antibody Hosts
Conjugates
Modifications
Pathways
- Cell cycle (8)
- DNA replication (5)
- Non-homologous end-joining (5)
- Pathways in cancer (4)
- Chronic myeloid leukemia (3)
- Nucleotide excision repair (3)
- RNA degradation (3)
- Colorectal cancer (2)
- Gap junction (2)
- Homologous recombination (2)
- Huntington's disease (2)
- Mismatch repair (2)
- Notch signaling pathway (2)
- Oocyte meiosis (2)
- Progesterone-mediated oocyte maturation (2)
- Small cell lung cancer (2)
- p53 signaling pathway (2)
- Acute myeloid leukemia (1)
- Amyotrophic lateral sclerosis (ALS) (1)
- Apoptosis (1)
- Bladder cancer (1)
- Endometrial cancer (1)
- ErbB signaling pathway (1)
- Focal adhesion (1)
- Jak-STAT signaling pathway (1)
- MAPK signaling pathway (1)
- Neurotrophin signaling pathway (1)
- Prostate cancer (1)
- Proteasome (1)
- Spliceosome (1)
- TGF-beta signaling pathway (1)
- Thyroid cancer (1)
- Type I diabetes mellitus (1)
- Wnt signaling pathway (1)