Germany
Japan
United Kingdom
China
Antibodies
Download
Rabbit Polyclonal Anti-PHB Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHB |
TA349430 is a possible alternative to TA322982.
Rabbit anti-AHCY Polyclonal Antibody
| Applications | ICC/IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human AHCY |
Rabbit Polyclonal Anti-TMPRSS6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6. Synthetic peptide located within the following region: LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSAFRSETAKAQK |
Rabbit Polyclonal Anti-HNRPD Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRPD antibody: synthetic peptide directed towards the C terminal of human HNRPD. Synthetic peptide located within the following region: YGYNSQGYGGYGGYDYTGYNNYYGYGDYSNQQSGYGKVSRRGGHQNSYKP |
Rabbit anti-VEGFR (Phospho-Tyr951) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanVEGFR2 around the phosphorylation site of tyrosine 951 (K-D-YP-V-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-BDNF antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This IgG fraction antibody was prepared from rabbit antiserum after repeated immunizations with recombinant truncated human BDNF protein produced in E.coli. |
Rabbit polyclonal anti-TUBB(beta Tubulin) antibody, Loading control
| Applications | WB |
| Reactivities | Human, Mouse, Chicken, Xenopus, Porcine, Zebrafish, Hamster, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to the N-terminal region of human beta tubulin (within residues 1-100). Swiss-Prot P07437. |
Rabbit polyclonal IRS-1 (Ab-312) antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human IRS-1 around the phosphorylation site of serine 312 (A-T-SP-P-A). |
Rabbit Polyclonal Anti-HNRNPU Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HNRNPU antibody: synthetic peptide directed towards the C terminal of human HNRNPU. Synthetic peptide located within the following region: EITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQF |
Goat Polyclonal Anti-CD45 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from within residues 1,260 aa to the C-terminus of human CD45 produced in E. coli. |
Rabbit Anti-NMDA NR2B Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the C-terminal region of the NR2B subunit |
Rabbit polyclonal anti-MBTPS1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human MBTPS1. |
Rabbit Polyclonal Anti-NOTCH2 (Cleaved-Ala1734) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NOTCH2 (Cleaved-Ala1734) Antibody: A synthesized peptide derived from human NOTCH2 (Cleaved-Ala1734) |
Goat Polyclonal Anti-CD19 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide within residues 510 aa to the C-terminus of human CD19 produced in E. coli. |
Rabbit Polyclonal antibody to GAD65 (glutamate decarboxylase 2 (pancreatic islets and brain, 65kDa))
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 353 and 585 of GAD65 (Uniprot ID#Q05329) |
Rabbit polyclonal IRF-3 (Ser385) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRF-3 around the phosphorylation site of serine 385 (G-A-SP-S-L). |
| Modifications | Phospho-specific |
Rabbit polyclonal eNOS (Thr495) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human eNOS around the phosphorylation site of threonine 495 (K-K-TP-F-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Aqp2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Aqp2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ALSIGFSVTLGHLLGIYFTGCSMNPARSLAPAVVTGKFDDHWVFWIGPLV |
Goat Polyclonal Anti-VEGFR2 Antibody
| Applications | WB |
| Reactivities | Canine, Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Purified recombinant peptide derived from the N-terminus (residues 20-125 aa) of human VEGFR2 produced in E. coli. |
Goat Polyclonal Antibody against DKK1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CDHHQASNSSRLHT, from the C Terminus of the protein sequence according to NP_036374. |
Active filters
Applications
- WB
Isotypes
- IgG
Conjugates
- Unconjugated
Families
- Druggable Genome
Availabilities
- In Stock
Filter by
Target Symbol
- EGFR (18)
- MAPT (18)
- AKT1 (16)
- TP53 (15)
- JUN (14)
- EZR (13)
- NR3C1 (12)
- CHEK1 (11)
- RELA (11)
- ATF2 (10)
- MET (10)
- PRKCD (10)
- SRC (10)
- ERBB2 (9)
- GRIN2B (9)
- MAPK14 (9)
- PAK1 (9)
- PDGFRB (9)
- RPS6KB1 (9)
- BRAF (8)
- CHUK (8)
- CREB1 (8)
- CSF1R (8)
- CTNNB1 (8)
- FGFR1 (8)
- FOXO1 (8)
- IKBKG (8)
- IRS1 (8)
- NFKB1 (8)
- NOS3 (8)
- PRKCA (8)
- PTK2 (8)
- PTPN11 (8)
- RAF1 (8)
- RUNX1 (8)
- STAT5A (8)
- CASP3 (7)
- CCNB1 (7)
- CDC25A (7)
- CDK2 (7)
- CFLAR (7)
- ESR1 (7)
- MAP2K1 (7)
- MAP2K4 (7)
- MAPK3 (7)
- PPP1R1B (7)
- PXN (7)
- RPS6KA5 (7)
- SNCA (7)
- STAT1 (7)
- ABL1 (6)
- AFP (6)
- BCL2L1 (6)
- CASP7 (6)
- CTSD (6)
- DPYSL2 (6)
- ELK1 (6)
- EPHA2 (6)
- GAB2 (6)
- GJA1 (6)
- GSK3A (6)
- HDAC1 (6)
- IGF1R (6)
- JAK2 (6)
- LMNA (6)
- NFKBIA (6)
- NGFR (6)
- RAB27A (6)
- RB1 (6)
- SHC1 (6)
- SMAD1 (6)
- SMAD3 (6)
- STAT3 (6)
- SYK (6)
- TH (6)
- AGT (5)
- AKR1B1 (5)
- APP (5)
- BAD (5)
- BAX (5)
- BLNK (5)
- BRCA1 (5)
- CAMK2A (5)
- CASP9 (5)
- CAV1 (5)
- CCNE1 (5)
- CD19 (5)
- CDC25B (5)
- CDK1 (5)
- CDKN1A (5)
- CEBPA (5)
- CHEK2 (5)
- CYP2D6 (5)
- DNM1 (5)
- DUSP1 (5)
- F10 (5)
- HDAC2 (5)
- HSD17B13 (5)
- INSR (5)
- IRF3 (5)
Reactivities
- Human (4099)
- Mouse (3172)
- Rat (2566)
- Monkey (115)
- Canine (90)
- Dog (73)
- Bovine (35)
- Pig (32)
- Cow (28)
- Chicken (20)
- Xenopus (11)
- X. tropicalis (10)
- Rhesus Monkey (9)
- Zebrafish (9)
- Chimpanzee (7)
- Rabbit (5)
- Porcine (3)
- Sheep (3)
- Hamster (2)
- Drosophila (1)
- Feline (1)
- Ferret (1)
- Fish (1)
- Guinea Pig (1)
- Horse (1)
Antibody Hosts
Clonalities
Knockout (KO) Validation
Modifications
Pathways
- Pathways in cancer (623)
- MAPK signaling pathway (420)
- Focal adhesion (353)
- Metabolic pathways (317)
- Neurotrophin signaling pathway (314)
- Prostate cancer (288)
- ErbB signaling pathway (280)
- Chemokine signaling pathway (263)
- Regulation of actin cytoskeleton (256)
- Chronic myeloid leukemia (250)
- T cell receptor signaling pathway (230)
- Colorectal cancer (228)
- Pancreatic cancer (228)
- Insulin signaling pathway (220)
- Cell cycle (212)
- Cytokine-cytokine receptor interaction (207)
- Toll-like receptor signaling pathway (194)
- Apoptosis (193)
- Small cell lung cancer (193)
- Glioma (192)
- Acute myeloid leukemia (183)
- Melanoma (181)
- Neuroactive ligand-receptor interaction (181)
- B cell receptor signaling pathway (177)
- GnRH signaling pathway (176)
- Epithelial cell signaling in Helicobacter pylori infection (172)
- Wnt signaling pathway (170)
- Progesterone-mediated oocyte maturation (169)
- Calcium signaling pathway (168)
- Non-small cell lung cancer (168)
- Jak-STAT signaling pathway (165)
- Fc gamma R-mediated phagocytosis (164)
- Natural killer cell mediated cytotoxicity (163)
- Endometrial cancer (162)
- Adherens junction (160)
- VEGF signaling pathway (160)
- Fc epsilon RI signaling pathway (159)
- Leukocyte transendothelial migration (158)
- Adipocytokine signaling pathway (157)
- Endocytosis (156)
- Renal cell carcinoma (152)
- Alzheimer's disease (149)
- Bladder cancer (141)
- Axon guidance (139)
- Oocyte meiosis (134)
- p53 signaling pathway (133)
- Gap junction (130)
- Melanogenesis (122)
- Amyotrophic lateral sclerosis (ALS) (121)
- NOD-like receptor signaling pathway (119)
- Tight junction (115)
- Vascular smooth muscle contraction (115)
- Huntington's disease (110)
- Long-term potentiation (110)
- RIG-I-like receptor signaling pathway (99)
- mTOR signaling pathway (89)
- Long-term depression (86)
- TGF-beta signaling pathway (84)
- Type II diabetes mellitus (83)
- Pathogenic Escherichia coli infection (81)
- Hematopoietic cell lineage (77)
- Thyroid cancer (74)
- Ubiquitin mediated proteolysis (67)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (64)
- Hypertrophic cardiomyopathy (HCM) (61)
- Cell adhesion molecules (CAMs) (59)
- Cytosolic DNA-sensing pathway (59)
- Dilated cardiomyopathy (57)
- Viral myocarditis (55)
- Parkinson's disease (53)
- Basal cell carcinoma (51)
- Prion diseases (51)
- Complement and coagulation cascades (47)
- Dorso-ventral axis formation (47)
- Phosphatidylinositol signaling system (44)
- Glycolysis / Gluconeogenesis (43)
- Olfactory transduction (42)
- Vibrio cholerae infection (42)
- ECM-receptor interaction (39)
- Primary immunodeficiency (39)
- Purine metabolism (38)
- Lysosome (37)
- Antigen processing and presentation (35)
- Arginine and proline metabolism (35)
- Notch signaling pathway (35)
- PPAR signaling pathway (34)
- ABC transporters (33)
- Drug metabolism - cytochrome P450 (31)
- Pyruvate metabolism (29)
- Base excision repair (28)
- Fructose and mannose metabolism (28)
- Glycerolipid metabolism (28)
- Systemic lupus erythematosus (28)
- Metabolism of xenobiotics by cytochrome P450 (27)
- Inositol phosphate metabolism (24)
- Nucleotide excision repair (24)
- Hedgehog signaling pathway (23)
- Retinol metabolism (22)
- SNARE interactions in vesicular transport (21)
- Tryptophan metabolism (21)
- Tyrosine metabolism (21)
- Arachidonic acid metabolism (20)
- Mismatch repair (20)
- Renin-angiotensin system (20)
- Valine (20)
- Butanoate metabolism (19)
- Homologous recombination (19)
- Nitrogen metabolism (19)
- Pyrimidine metabolism (19)
- DNA replication (18)
- Type I diabetes mellitus (18)
- leucine and isoleucine degradation (18)
- Alanine (16)
- Androgen and estrogen metabolism (16)
- Cardiac muscle contraction (16)
- Fatty acid metabolism (16)
- Galactose metabolism (16)
- Pentose phosphate pathway (16)
- aspartate and glutamate metabolism (16)
- Histidine metabolism (15)
- Propanoate metabolism (14)
- Regulation of autophagy (14)
- Citrate cycle (TCA cycle) (13)
- Drug metabolism - other enzymes (13)
- Taste transduction (13)
- Amino sugar and nucleotide sugar metabolism (12)
- Glutathione metabolism (12)
- Maturity onset diabetes of the young (12)
- Autoimmune thyroid disease (11)
- Non-homologous end-joining (11)
- beta-Alanine metabolism (11)
- Allograft rejection (10)
- Cysteine and methionine metabolism (10)
- Glycerophospholipid metabolism (10)
- Linoleic acid metabolism (10)
- Oxidative phosphorylation (10)
- Primary bile acid biosynthesis (10)
- Graft-versus-host disease (9)
- Lysine degradation (9)
- Phenylalanine metabolism (9)
- Sphingolipid metabolism (9)
- Starch and sucrose metabolism (9)
- Ascorbate and aldarate metabolism (8)
- C21-Steroid hormone metabolism (8)
- Proteasome (8)
- Asthma (7)
- Limonene and pinene degradation (7)
- Pentose and glucuronate interconversions (7)
- Basal transcription factors (6)
- Fatty acid biosynthesis (6)
- Folate biosynthesis (6)
- Glycine (6)
- Other glycan degradation (6)
- Ribosome (6)
- serine and threonine metabolism (6)
- Methane metabolism (5)
- Terpenoid backbone biosynthesis (5)
- Caffeine metabolism (4)
- Circadian rhythm - mammal (4)
- Glycosaminoglycan degradation (4)
- One carbon pool by folate (4)
- Porphyrin and chlorophyll metabolism (4)
- RNA degradation (4)
- Selenoamino acid metabolism (4)
- Taurine and hypotaurine metabolism (4)
- leucine and isoleucine biosynthesis (4)
- Nicotinate and nicotinamide metabolism (3)
- Pantothenate and CoA biosynthesis (3)
- Riboflavin metabolism (3)
- Spliceosome (3)
- Steroid biosynthesis (3)
- Synthesis and degradation of ketone bodies (3)
- Vitamin B6 metabolism (3)
- Aminoacyl-tRNA biosynthesis (2)
- Biosynthesis of unsaturated fatty acids (2)
- Ether lipid metabolism (2)
- Glycosphingolipid biosynthesis - ganglio series (2)
- Glyoxylate and dicarboxylate metabolism (2)
- Heparan sulfate biosynthesis (2)
- N-Glycan biosynthesis (2)
- Chondroitin sulfate biosynthesis (1)
- Glycosphingolipid biosynthesis - globo series (1)
- Lysine biosynthesis (1)
- O-Glycan biosynthesis (1)
- Phenylalanine (1)
- Ubiquinone and other terpenoid-quinone biosynthesis (1)
- alpha-Linolenic acid metabolism (1)
- tyrosine and tryptophan biosynthesis (1)