Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal anti-Jagged 1 antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 110-125 of human Jagged-1protein. |
Rabbit polyclonal anti-DELTA-4 antibody
| Applications | IHC, WB |
| Reactivities | Human, partial reactivity to Mouse and Rat |
| Conjugation | Unconjugated |
| Immunogen | Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4. |
Rabbit polyclonal DVL1 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DVL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 442-470 amino acids from the Central region of human DVL1. |
Rabbit Polyclonal Anti-Notch 1 (Cleaved-Val1744) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Notch 1 (Cleaved-Val1744) Antibody: A synthesized peptide derived from human Notch 1 (Cleaved-Val1744) |
Rabbit polyclonal DVL3 Antibody (C-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This DVL3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 530-557 amino acids from the C-terminal region of human DVL3. |
Rabbit Polyclonal Anti-DLL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DLL3 antibody is: synthetic peptide directed towards the C-terminal region of Human DLL3. Synthetic peptide located within the following region: LVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQRYLLPPALGLL |
Rabbit Polyclonal Anti-HES5 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human HES5 |
Rabbit polyclonal anti-NOTCH 1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | This whole rabbit serum was prepared by repeated immunizations with a synthetic peptide corresponding to amino acid residues of human Notch 1 located near the N-terminal sequence of the cleaved N intracellular domain (NICD). |
Rabbit Polyclonal Anti-DVL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the middle region of human DVL1. Synthetic peptide located within the following region: LKITIANAVIGADVVDWLYTHVEGFKERREARKYASSLLKHGFLRHTVNK |
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL2 antibody: synthetic peptide directed towards the N terminal of human DVL2. Synthetic peptide located within the following region: AGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPA |
Rabbit Polyclonal Anti-DLL1 Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL1 antibody: synthetic peptide directed towards the N terminal of human DLL1. Synthetic peptide located within the following region: GSRCALALAVLSALLCQVWSSGVFELKLQEFVNKKGLLGNRNCCRGGAGP |
Rabbit Polyclonal Anti-DLL3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL3 antibody: synthetic peptide directed towards the N terminal of human DLL3. Synthetic peptide located within the following region: MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC |
Goat Anti-DLL1 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ATQRHLTVGEEWSQD, from the internal region of the protein sequence according to NP_005609.3. |
Rabbit Polyclonal APH1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | APH1 antibody was raised against a 13 amino acid peptide from near the amino terminus of human APH1a. |
Rabbit polyclonal anti-DVL2 antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DVL2. |
Rabbit polyclonal anti-Dvl3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 583 of mouse Dvl3 |
Goat Anti-DLL4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence KNTNQKKELEVDC, from the internal region of the protein sequence according to NP_061947.1. |
Dvl1 Goat Polyclonal Antibody
| Applications | WB |
| Reactivities | Pig |
| Conjugation | Unconjugated |
| Immunogen | N Terminus (KLPVAPERVTLAD) |
Rabbit Polyclonal Anti-DVL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DVL1 antibody: synthetic peptide directed towards the C terminal of human DVL1. Synthetic peptide located within the following region: AAGAGGSGSESDHTAPSGVGSSWRERPAGQLSRGSSPRSQASATAPGLPP |
Rabbit Polyclonal Anti-DVL2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DVL2 antibody is: synthetic peptide directed towards the middle region of Human DVL2. Synthetic peptide located within the following region: HRTGGPSRLERHLAGYESSSTLMTSELESTSLGDSDEEDTMSRFSSSTEQ |
Rabbit polyclonal Anti-DLL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: PGPCTFGTVSTPVLGTNSFAVRDDSSGGGRNPLQLPFNFTWPGTFSLIIE |
Rabbit polyclonal Anti-DLL4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DLL4 antibody: synthetic peptide directed towards the N terminal of human DLL4. Synthetic peptide located within the following region: QGSLAVGQNWLLDEQTSTLTRLRYSYRVICSDNYYGDNCSRLCKKRNDHF |
Rabbit Polyclonal Anti-HES5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HES5 antibody: synthetic peptide directed towards the middle region of human HES5. Synthetic peptide located within the following region: AASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAH |
Anti-NOTCH1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2541-2555 amino acids of Human notch 1 |
Anti-NOTCH1 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 2541-2555 amino acids of human notch 1 |
Active filters
Category
- Antibodies
Reactivities
- Human
Applications
- WB
Clonalities
- Polyclonal
Conjugates
- Unconjugated
Families
- ES Cell Differentiation/IPS
Pathways
- Notch signaling pathway