Germany
Japan
United Kingdom
China
Rabbit anti-Phospho-AKT1/2/3-Y315/316/312 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding Y315/316/312 of human AKT1/AKT2/AKT3 |
Antibodies
View as table Download
Rabbit anti-MAPK14 Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MAPK14 |
Rabbit anti-IRAK3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IRAK3 |
Rabbit Polyclonal Anti-Phospho-RIPK2(Ser176) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-RIPK2(Ser176) Antibody: A synthesized peptide derived from human RIPK2 around the phosphorylation site of Sersine 176 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-p38 MAPK (Thr180/Tyr182) Antibody: A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Thr180/Tyr182) . |
| Modifications | Phospho-specific |
MEK1 (MAP2K1) (N-term) rabbit polyclonal antibody, Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat, Xenopus |
| Immunogen | MAP2K1 antibody was raised against synthetic peptide derived from sequence near the amino-terminus of human MEK1, conjugated to KLH |
Rabbit polyclonal AKT1/2/3 (Ab-315/316/312) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human AKT1/2/3 around the phosphorylation site of tyrosine 315/316/312 (P-E-YP-L-A). |
Rabbit polyclonal MSK1 (Ser212) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MSK1 around the phosphorylation site of serine 212 (A-Y-SP-F-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal PKCd (Ser645) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PKCd around the phosphorylation site of serine 645 (R-L-SP-Y-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal MAP2K7 (Thr275) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP2K7 around the phosphorylation site of threonine 275 (A-K-TP-R-S). |
| Modifications | Phospho-specific |
Rabbit polyclonal MAPKAPK2 (Ab-272) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human MAPKAPK2 around the phosphorylation site of serine 272 (A-I-SP-P-G). |
Rabbit polyclonal MAPKAPK2 (Ser272) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAPKAPK2 around the phosphorylation site of serine 272 (A-I-SP-P-G). |
| Modifications | Phospho-specific |
Rabbit polyclonal Raf1 (Tyr341) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Raf1 around the phosphorylation site of tyrosine 341 (S-Y-YP-W-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal Akt (Thr450) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human AKT1 around the phosphorylation site of threonine 450 (T-I-TP-P-P). |
| Modifications | Phospho-specific |
Rabbit polyclonal CaMK2-beta/gamma/delta (Thr287) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CaMK2-β/?/d around the phosphorylation site of threonine 287 (Q-E-TP-V-E). |
| Modifications | Phospho-specific |
Rabbit polyclonal IRAK1 (Thr209) antibody(Phospho-specific)
| Applications | WB |
| Reactivities | Human: Thr209 |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IRAK1 around the phosphorylation site of threonine 209 (R-G-TP-H-N). |
| Modifications | Phospho-specific |
Rabbit polyclonal MAP3K1 (Thr1402) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MAP3K1 around the phosphorylation site of threonine 1402 (K-G-TP-G-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal AKT2 Antibody (C-term)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This AKT2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 416-444 amino acids from the C-terminal region of human AKT2. |
Rabbit polyclonal RSK2 (RPS6KA3) Antibody (N-term)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This RSK2 (RPS6KA3) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 13-42 amino acids from the N-terminal region of human RSK2 (RPS6KA3). |
Rabbit Polyclonal p38 MAPK (Tyr322) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human p38 MAPK around the phosphorylation site of Tyrosine 322 |
| Modifications | Phospho-specific |
Rabbit Polyclonal ERK1/2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 |
Rabbit Polyclonal ERK1/2 (Thr202/Tyr204) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human ERK1/2 around the phosphorylation site of Threonine 202/Tyrosine 204 |
| Modifications | Phospho-specific |
Rabbit polyclonal p90 RSK (Ab-573) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human p90 RSK around the phosphorylation site of threonine 573 (L-M-TP-P-C). |
Rabbit polyclonal Trk A (Phospho-Tyr701) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Trk A around the phosphorylation site of tyrosine 701 (I-L-YP-R-K). |
| Modifications | Phospho-specific |
Rabbit polyclonal p90 RSK (Phospho-Thr573) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human P90RSK around the phosphorylation site of threonine 573 (L-M-TP-P-C). |
| Modifications | Phospho-specific |
Rabbit polyclonal B-RAF (Ab-446) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human B-RAF around the phosphorylation site of serine 446 (R-D-SP-S-D). |
MEK2 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | C term -peptide of human MEK2 |
Rabbit anti-JNK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | C term -peptide of human JNK2 |
MAPK10 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MAPK10 |
Rabbit anti-Phospho-MAPK8/9/10-T183/Y185 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T183/Y185 of human MAPK8/MAPK9/MAPK10 |
Phospho-AKT1-S473 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding S473 of human AKT1 |
| Modifications | Phospho-specific |
Phospho-AKT1-T308 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A phospho specific peptide corresponding to residues surrounding T308 of human AKT1 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-IRAK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IRAK3 antibody: synthetic peptide directed towards the C terminal of human IRAK3. Synthetic peptide located within the following region: NTLESTQASLYFAEDPPTSLKSFRCPSPLFLENVPSIPVEDDESQNNNLL |
Active filters
Category
- Antibodies
Applications
- WB
Clonalities
- Polyclonal
Families
- Protein Kinase
Pathways
- Neurotrophin signaling pathway
Filter by
Target Symbol
- AKT1 (53)
- MAPK14 (25)
- RAF1 (24)
- MAP2K1 (21)
- MAPK8 (20)
- PRKCD (18)
- ABL1 (17)
- MAP3K5 (17)
- GSK3B (16)
- BRAF (15)
- MAPK3 (14)
- MAPK1 (13)
- RPS6KA1 (13)
- AKT2 (12)
- NTRK2 (10)
- RPS6KA5 (10)
- IKBKB (9)
- MAPKAPK2 (9)
- CAMK2A (8)
- MAP2K2 (8)
- RIPK2 (8)
- CSK (7)
- AKT3 (6)
- CAMK2B (6)
- CAMK4 (6)
- IRAK1 (6)
- IRAK2 (6)
- IRAK3 (6)
- PDK1 (6)
- IRAK4 (5)
- MAP2K7 (5)
- MAPK9 (5)
- NTRK1 (5)
- CAMK2G (4)
- MAPK10 (4)
- MAPK12 (4)
- CAMK2D (3)
- NTRK3 (3)
- RPS6KA4 (3)
- MAP2K5 (2)
- MAP3K1 (2)
- MAP3K3 (2)
- MAPK11 (2)
- MAPK7 (2)
- RPS6KA2 (2)
- RPS6KA3 (2)
- RPS6KA6 (2)
- MAPK13 (1)